Gene Information

Name : Vapar_5197 (Vapar_5197)
Accession : YP_002947065.1
Strain :
Genome accession: NC_012791
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5519735 - 5520406 bp
Length : 672 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: pna:Pnap_3958 two component transcriptional regulator

DNA sequence : 
ATGCGGATTCTGATTGCGGAAGACGACCAGGTGCTGGCCGATGCCCTGCTGCGCAGCCTGCGCACCTCGGGCGCGGCGGT
CGACCACGTGGCGAACGGATCGCAGGCCGACACCGCGCTCATGACGCACAGCGAGTTCGACCTGCTGATCCTCGACCTGG
GGCTGCCCAACCTGCACGGCATCGAGATCCTGAAGCGGCTGCGCGCACGCGGCTCGCAGCTGCCGGTGCTGGTGCTCACC
GCGGCCGACAGCGTGGAGGAGCGCGTCAAGGGCCTGGACCACGGCGCCGACGACTACATGGCCAAGCCCTTCAGCCTGCA
GGAGCTCGAGGCGCGCGTGCGGGCGCTCACGCGGCGCGGCATGGGCGCCACCAGCAACACGATCCGCCACGGCCCGCTGG
TGTACGACCAGGCCGGCCGGGTGGCCACCATCGACGGCAAGATGGTCGAGCTCTCGGCGCGCGAACTGGGCCTGCTGGAG
GTGCTGCTGCAGCGCGCCGGCCGCCTGGTCAGCAAGGACCAGCTGGTGGAGCGCCTGTGCGAATGGGGCGAGGAAGTGAG
CCTGAACGCGATCGAGGTCTACATCCACCGGCTGCGCAAGAAGATCGAGAAAGGCCCGGTGCGCATTGCAACGGTCCGAG
GCCTCGGCTACTGCCTCGAGAAGATTCCTTGA

Protein sequence : 
MRILIAEDDQVLADALLRSLRTSGAAVDHVANGSQADTALMTHSEFDLLILDLGLPNLHGIEILKRLRARGSQLPVLVLT
AADSVEERVKGLDHGADDYMAKPFSLQELEARVRALTRRGMGATSNTIRHGPLVYDQAGRVATIDGKMVELSARELGLLE
VLLQRAGRLVSKDQLVERLCEWGEEVSLNAIEVYIHRLRKKIEKGPVRIATVRGLGYCLEKIP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 3e-34 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Vapar_5197 YP_002947065.1 winged helix family two component transcriptional regulator BAC0487 Protein 8e-31 44
Vapar_5197 YP_002947065.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-29 44
Vapar_5197 YP_002947065.1 winged helix family two component transcriptional regulator BAC0638 Protein 3e-22 44
Vapar_5197 YP_002947065.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-25 42
Vapar_5197 YP_002947065.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 4e-27 42
Vapar_5197 YP_002947065.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Vapar_5197 YP_002947065.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-28 42
Vapar_5197 YP_002947065.1 winged helix family two component transcriptional regulator VFG0473 Protein 5e-32 42
Vapar_5197 YP_002947065.1 winged helix family two component transcriptional regulator VFG1389 Protein 4e-25 41