Gene Information

Name : Vapar_3563 (Vapar_3563)
Accession : YP_002945446.1
Strain :
Genome accession: NC_012791
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 3761741 - 3762214 bp
Length : 474 bp
Strand : +
Note : KEGG: mpt:Mpe_A1657 transcriptional regulator; TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional regulator; PFAM: transcription regulator MerR DNA binding; regulatory protein MerR; SMART: regulatory protein MerR

DNA sequence :
ATGAAAATCGGAGACCTGGCCAAGGCCGCGAACACGCCGGTCGAAACCATCCGGTACTACGAGCGCGAGCAGCTGCTGCC
CGCGCCCGCGCGCACCGAAGGCAACTACCGCATCTACGACGACGAGCATGCGCAGCGCCTGGGCTTCATCCGCCGCTGCC
GTTCCCTGGACATGACGCTCGACGAGATCCGCAACCTGCTCAGGTTCCGCGATGCGCCGGGCGAAGACTGCGGCGAGGTC
AACCAGCTGCTCGACGACCACATCGGCCACGTGGCCGCGCGCATCCGCGAGCTCAAAACGCTGGAAAAGCAGCTGAAGGC
GCTGCGCCAGCAATGCTGCGGGCCCGAATCAGCACGCAACTGCGGCATCCTGCAGGAGCTGGACACCGCCGCGCCCGCGG
CCGAGCCTTTCGGGCAGCATGCGGGGCATGTGCATGGGTCGCTGCACAGCGCGTCCGCGAAGCGTTCGGCTTGA

Protein sequence :
MKIGDLAKAANTPVETIRYYEREQLLPAPARTEGNYRIYDDEHAQRLGFIRRCRSLDMTLDEIRNLLRFRDAPGEDCGEV
NQLLDDHIGHVAARIRELKTLEKQLKALRQQCCGPESARNCGILQELDTAAPAAEPFGQHAGHVHGSLHSASAKRSA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 8e-36 55
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 2e-33 48
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 4e-34 48
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 3e-34 48
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 1e-33 48
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 1e-33 48
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 3e-34 48
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 2e-33 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Vapar_3563 YP_002945446.1 MerR family transcriptional regulator BAC0301 Protein 1e-35 58
Vapar_3563 YP_002945446.1 MerR family transcriptional regulator BAC0058 Protein 1e-41 57