Gene Information

Name : Kole_0915 (Kole_0915)
Accession : YP_002940628.1
Strain : Kosmotoga olearia TBF 19.5.1
Genome accession: NC_012785
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 967610 - 968275 bp
Length : 666 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bha:BH0372 two-component response regulator

DNA sequence :
TTGAAAGCAAAAGTGCTTCTCGTAGAGGATGATCCTCACATAAGAAAATTCATTCAGCTGGAACTCGAACACGAAGGCTA
TGAAGTAAAAACAGCCGTTACCGGTCCACAAGCTCTCGACGAACTTGAAAAGGAGCTTCCAGATGTTGTTTTGCTGGATG
TGATGTTGCCGGAGATGAATGGTTTTACCGTGTTAGAAAGAATCCGGGAAGACTTTTCAACGGAGCTTCCAGTAATTATG
TTGACAGCTCGAGGAGAGCTGGAAGATCGGGTCAGGGGATTGAAAAGTGGTGCTGATGATTACATAGTAAAACCTTTCCA
CATTGAAGAGCTTTTGGCCAGACTGGAAGCAGTCCTGAGAAGAAAGGGCTATTCAGAAAAAATTTTATACGGTAATATAG
AAATGAACCTCTCTTCCAGAGAGGTAAAGGTTAATGGTGAACCTGTCGAGCTTAGTAGGACAGAGTTTGATTTGCTAAAA
GTCCTTCTTACGAATGCAGGAATCGTTATGTCAAAAGATAGGCTGTTAGAGCTGGTATGGGGAACGGAAGAATGGGGGAA
TCCTAACGTTGTGGAAGTGTACATAAATTATCTGCGAAAGAAACTTGGATCAGCGGGGAAGATCATAAAAACGGTAAGAG
GTGTTGGTTACGTTGCGAAGGAGTAA

Protein sequence :
MKAKVLLVEDDPHIRKFIQLELEHEGYEVKTAVTGPQALDELEKELPDVVLLDVMLPEMNGFTVLERIREDFSTELPVIM
LTARGELEDRVRGLKSGADDYIVKPFHIEELLARLEAVLRRKGYSEKILYGNIEMNLSSREVKVNGEPVELSRTEFDLLK
VLLTNAGIVMSKDRLLELVWGTEEWGNPNVVEVYINYLRKKLGSAGKIIKTVRGVGYVAKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 2e-17 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kole_0915 YP_002940628.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-23 46
Kole_0915 YP_002940628.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 3e-28 45
Kole_0915 YP_002940628.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 3e-28 45
Kole_0915 YP_002940628.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 3e-28 45
Kole_0915 YP_002940628.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 3e-28 45
Kole_0915 YP_002940628.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 3e-28 45
Kole_0915 YP_002940628.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 3e-28 45
Kole_0915 YP_002940628.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 3e-28 45
Kole_0915 YP_002940628.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 3e-28 45
Kole_0915 YP_002940628.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 3e-27 44
Kole_0915 YP_002940628.1 two component transcriptional regulator, winged helix family BAC0125 Protein 3e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kole_0915 YP_002940628.1 two component transcriptional regulator, winged helix family VFG1386 Protein 2e-30 45
Kole_0915 YP_002940628.1 two component transcriptional regulator, winged helix family VFG1389 Protein 3e-29 44