Gene Information

Name : Kole_1571 (Kole_1571)
Accession : YP_002941265.1
Strain : Kosmotoga olearia TBF 19.5.1
Genome accession: NC_012785
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1683977 - 1684696 bp
Length : 720 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sat:SYN_00981 response regulator

DNA sequence :
GTGGCCAAAAAGAACATATTGGTAATTGATGATGAGCCATCGATCGTCGAGCTTCTTAGTTTCAACCTCAAGAAAGAGGG
ATATGATGTCTTAAAGGCTTATGATGCCGAGGAAGCTCTCAAAATTGTAGAGGACAACGATGTTGACATGTTCATAGTAG
ACATCATGCTTCCTGGAATGGACGGTTTTGAATTGGTAAGAAACCTGAGGAGTACGGAAAAACACAGACATACTCCTGTG
ATATTCCTCAGTGCTAAAAGCGAAGAGTTTGACAAGGTTCTTGGGTTGGAACTTGGTGCTGACGATTATATTACGAAGCC
ATTCAGTGTCAGGGAGGCTCTAGCGAGGATAAGGGCTATATTCAGAAGGATCCAGCAGAGCGTTCAGGCAAAGGAAGAGA
GACCTAAGAAGATAACGGCAAGAGACCTTGAAATAGACACTGAGAAGTATGAAGTGAGAGTCAGAGGGAAACTGGTCAAT
TTAACACCTCTTGAGTTTGAGCTCCTTAGATTCCTCGCTGAGAATGAAGGTAAGGTTTTCAGCAGGGATGTCCTTCTCGA
CAAACTCTGGGGTTACGATTACTATGGTGACACCAGAACTGTTGATGTTCATATAAGACGCCTGAGAACGAAGATCGAAG
AGGATCCTTCCAATCCTAAATATATCATAACAGTGAGGGGTAAAGGATACAAATTCAGAGACCCTGGAAAGGAAGACTGA

Protein sequence :
MAKKNILVIDDEPSIVELLSFNLKKEGYDVLKAYDAEEALKIVEDNDVDMFIVDIMLPGMDGFELVRNLRSTEKHRHTPV
IFLSAKSEEFDKVLGLELGADDYITKPFSVREALARIRAIFRRIQQSVQAKEERPKKITARDLEIDTEKYEVRVRGKLVN
LTPLEFELLRFLAENEGKVFSRDVLLDKLWGYDYYGDTRTVDVHIRRLRTKIEEDPSNPKYIITVRGKGYKFRDPGKED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-36 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-36 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 3e-45 52
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 1e-46 49
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 1e-45 48
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 1e-41 46
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 6e-40 45
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-45 45
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-45 45
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-45 45
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-45 45
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-45 45
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-45 45
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-45 45
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-45 45
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-45 45
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-45 45
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 5e-37 43
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 2e-38 43
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 2e-38 43
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 2e-39 42
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 3e-41 42
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family BAC0125 Protein 9e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family VFG1563 Protein 5e-36 45
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family VFG1702 Protein 9e-37 45
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family VFG1386 Protein 3e-35 44
Kole_1571 YP_002941265.1 two component transcriptional regulator, winged helix family VFG1389 Protein 3e-26 42