Gene Information

Name : Kole_1429 (Kole_1429)
Accession : YP_002941125.1
Strain : Kosmotoga olearia TBF 19.5.1
Genome accession: NC_012785
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1523906 - 1524592 bp
Length : 687 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: gsu:GSU0451 DNA-binding response regulator

DNA sequence :
GTGAAAATACTGGTTGTTGAGGACAACAAAAAACTTGCAGAAAATATAAAAAAATATCTTGAACTCGAAGGTTTCATCGT
TGACCTGGCATATGACGGAAACGAAGGTCTGGATCTCGCGCTTTCCTATAACTACGACTGTATAATACTGGACATAATCT
TGCCCGGTATGTCAGGCATTGAAATTTGTCGTTTTTTGAGAGATGAAGAAAAGAGCCAGGTACCGATACTGATGCTCACG
GCACTGGGCAGTGTGGAAAATCGGGTGGAAGGACTTAATGTCGGTGCTGATGATTACATGCCAAAACCCTTTGACCTTAG
AGAACTTGTGGCAAGAGTCCGTGCACTCATCAGGAGAAATCAGGTTGTTCGTCAGGAAACTCTCAAATACGGCGACCTTG
TAATGAACCTGCAAACCAGGGAAGTCAGCTGTAAAGGGGAACCTCTGAATCTCAGCAGTAAAGAATTTTCACTCCTTGAG
CTTTTCATGCGTAATCCTGGTGTCGTATTTAGCAGAGAACAAATTCTTGATAAGTTATGGGAAAGCGGGTTCGAACCGCG
CAGTAATATCGTTGACGTTTATGTGCTCTACCTGAGAAAAAAGCTCAAACCTTTTGGTTACGACGAAAAAATAGAGACAG
TTCATAACATCGGGTATAGACTCAAGAAAGAAGATGATAAAACGTGA

Protein sequence :
MKILVVEDNKKLAENIKKYLELEGFIVDLAYDGNEGLDLALSYNYDCIILDIILPGMSGIEICRFLRDEEKSQVPILMLT
ALGSVENRVEGLNVGADDYMPKPFDLRELVARVRALIRRNQVVRQETLKYGDLVMNLQTREVSCKGEPLNLSSKEFSLLE
LFMRNPGVVFSREQILDKLWESGFEPRSNIVDVYVLYLRKKLKPFGYDEKIETVHNIGYRLKKEDDKT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-28 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family BAC0347 Protein 1e-31 46
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family BAC0111 Protein 6e-37 46
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 3e-33 43
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 3e-33 43
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 3e-33 43
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 3e-33 43
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 3e-33 43
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 3e-33 43
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 3e-33 43
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 3e-33 43
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 3e-29 43
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family BAC0125 Protein 2e-31 42
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family BAC0197 Protein 3e-29 42
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family BAC0083 Protein 5e-30 41
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 8e-29 41
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 5e-28 41
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-26 41
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-26 41
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-26 41
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-26 41
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-26 41
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-26 41
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-26 41
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-26 41
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family BAC0288 Protein 2e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family VFG0596 Protein 8e-29 43
Kole_1429 YP_002941125.1 two component transcriptional regulator, winged helix family VFG1390 Protein 4e-37 42