Gene Information

Name : NT01EI_1932 (NT01EI_1932)
Accession : YP_002933343.1
Strain : Edwardsiella ictaluri 93-146
Genome accession: NC_012779
Putative virulence/resistance : Resistance
Product : multidrug resistance protein, SMR family
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 1861888 - 1862220 bp
Length : 333 bp
Strand : +
Note : -

DNA sequence : 
ATGAATGGATATCTGTATCTGGCGATAGCGATCGGTGCCGAGGTTATCGCCACGACCGCTCTGAAAGCGACCCATGGCTT
TAGCCGACTAGGCCCTAGCCTAGTGGTGGTTATTGGATACGCCATTGCTTTCTGGGGACTTTCTCAAGTGGTAAAGAGCA
TTCCGCTGGGTGTCGCCTATGCGGTTTGGTCCGGTATGGGCATCGTGCTGGTCTCGCTGGCCGCCTACTGGCTGTACCAG
CAGGCGCTCGACTGGGCGGCGCTGCTGGGGATGGCAATGATCGTCGGGGGCGTGCTGGTGATCAATTTATTCTCCCACAC
ATCGGCACATTAA

Protein sequence : 
MNGYLYLAIAIGAEVIATTALKATHGFSRLGPSLVVVIGYAIAFWGLSQVVKSIPLGVAYAVWSGMGIVLVSLAAYWLYQ
QALDWAALLGMAMIVGGVLVINLFSHTSAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 2e-17 55
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 2e-17 55
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 2e-17 55
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 3e-17 55
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 2e-17 55
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 2e-17 55
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 2e-17 55
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 3e-17 55
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 2e-17 55
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 2e-17 55
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 2e-17 55
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 3e-17 55
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 2e-17 55
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 2e-17 55
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-17 55
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 3e-17 55
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 2e-17 55
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 2e-17 55
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-17 55
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 3e-17 55
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 2e-17 55
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-17 55
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 2e-17 55
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 2e-17 55
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-17 55
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 2e-17 55
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 2e-17 55
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 2e-17 55
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 2e-17 55
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 2e-17 55
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 9e-16 42
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 5e-11 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NT01EI_1932 YP_002933343.1 multidrug resistance protein, SMR family BAC0377 Protein 2e-30 67
NT01EI_1932 YP_002933343.1 multidrug resistance protein, SMR family CP004022.1.gene1549. Protein 1e-29 65
NT01EI_1932 YP_002933343.1 multidrug resistance protein, SMR family BAC0322 Protein 2e-21 59
NT01EI_1932 YP_002933343.1 multidrug resistance protein, SMR family BAC0324 Protein 9e-21 57
NT01EI_1932 YP_002933343.1 multidrug resistance protein, SMR family BAC0323 Protein 9e-18 55
NT01EI_1932 YP_002933343.1 multidrug resistance protein, SMR family NC_010410.6003348.p0 Protein 9e-22 54
NT01EI_1932 YP_002933343.1 multidrug resistance protein, SMR family BAC0002 Protein 9e-22 54
NT01EI_1932 YP_002933343.1 multidrug resistance protein, SMR family NC_002695.1.913273.p Protein 1e-19 53
NT01EI_1932 YP_002933343.1 multidrug resistance protein, SMR family BAC0150 Protein 1e-19 52
NT01EI_1932 YP_002933343.1 multidrug resistance protein, SMR family CP001138.1.gene1489. Protein 3e-22 51
NT01EI_1932 YP_002933343.1 multidrug resistance protein, SMR family BAC0477 Protein 8e-07 42
NT01EI_1932 YP_002933343.1 multidrug resistance protein, SMR family BAC0329 Protein 1e-13 42
NT01EI_1932 YP_002933343.1 multidrug resistance protein, SMR family BAC0192 Protein 5e-13 41
NT01EI_1932 YP_002933343.1 multidrug resistance protein, SMR family BAC0327 Protein 2e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NT01EI_1932 YP_002933343.1 multidrug resistance protein, SMR family VFG1586 Protein 4e-16 42
NT01EI_1932 YP_002933343.1 multidrug resistance protein, SMR family VFG1587 Protein 2e-11 42