Gene Information

Name : EUBELI_01854 (EUBELI_01854)
Accession : YP_002931290.1
Strain : Eubacterium eligens ATCC 27750
Genome accession: NC_012778
Putative virulence/resistance : Virulence
Product : two-component system OmpR family response regulator ResD
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1918156 - 1918857 bp
Length : 702 bp
Strand : +
Note : Psort-B: Cytoplasmic, score:9.98; COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; HMMPfam:IPR001789; HMMPfam:IPR001867; BlastProDom:IPR001789; BlastProDom:IPR001867; HMMSmart:IPR001789; superfam

DNA sequence :
ATGGCATCTAAACAGCGAATACTTATTGTAGATGATGATGAAAATATTGCAGAACTTATATCTTTGTATCTTACAAAAGA
ATGTTACGAAACAAAGATTGTGTATGATGGAGAAAGTGCTCTGTCTGAGCTTTCTGTATTCAAGCCCAATCTCATTCTTT
TAGACCTCATGCTTCCCGGTATTGACGGCTATCAGGTGTGCCGTGAGATAAGAAAGAATAACAATGTTCCTATAATTATG
CTCTCCGCCAAGGGCGAAACATTTGACAAGGTACTAGGACTTGAGCTTGGTGCAGATGACTATATTATCAAACCTTTTGA
AACTAAAGAGATGGTTGCCCGTGTAAAGGCTGTGCTTAGAAGATACCATATGCCTCAGAGTATCGGTGTTGATTCTTCTA
ATGCCAAATGTGTCAATTACCCCGACCTCTCTATCAACCTCGATAATTATTCGGTTAATTATATGGGCAAAAATGTCGAG
ATGCCACCTAAGGAACTTGAGCTCTTATATTTCTTAGCATCTGCTCCTAATCAGGTGTTTACAAGAGAACAGCTTCTTGA
CAATATATGGGGATATGAATATATCGGAGATACAAGAACCGTTGATGTACACATTAAGAGAATCCGTGAGAAAATCAAGG
ATCATGTCCACTGGAATATTGAAACAGTATGGGGAATTGGTTACAAGTTCGTAACTAAATAA

Protein sequence :
MASKQRILIVDDDENIAELISLYLTKECYETKIVYDGESALSELSVFKPNLILLDLMLPGIDGYQVCREIRKNNNVPIIM
LSAKGETFDKVLGLELGADDYIIKPFETKEMVARVKAVLRRYHMPQSIGVDSSNAKCVNYPDLSINLDNYSVNYMGKNVE
MPPKELELLYFLASAPNQVFTREQLLDNIWGYEYIGDTRTVDVHIKRIREKIKDHVHWNIETVWGIGYKFVTK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-36 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_012469.1.7685629. Protein 1e-51 49
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_012469.1.7686381. Protein 1e-41 46
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD AE000516.2.gene3505. Protein 4e-44 45
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD AE015929.1.gene1106. Protein 5e-37 44
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_002952.2859905.p0 Protein 5e-46 44
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_007793.3914279.p0 Protein 3e-46 44
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_007622.3794472.p0 Protein 4e-46 44
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_002745.1124361.p0 Protein 3e-46 44
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_009782.5559369.p0 Protein 3e-46 44
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_002951.3237708.p0 Protein 3e-46 44
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_003923.1003749.p0 Protein 3e-46 44
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_002758.1121668.p0 Protein 3e-46 44
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_009641.5332272.p0 Protein 3e-46 44
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD AF155139.2.orf0.gene Protein 9e-44 44
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_013450.8614421.p0 Protein 3e-46 44
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD HE999704.1.gene2815. Protein 5e-44 44
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_002951.3238224.p0 Protein 3e-41 43
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_007793.3914065.p0 Protein 3e-41 43
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_002758.1121390.p0 Protein 3e-41 43
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_010079.5776364.p0 Protein 3e-41 43
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_002952.2859858.p0 Protein 3e-41 43
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_007622.3794948.p0 Protein 3e-41 43
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_003923.1003417.p0 Protein 3e-41 43
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_013450.8614146.p0 Protein 3e-41 43
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD FJ349556.1.orf0.gene Protein 9e-43 43
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD HE999704.1.gene1528. Protein 4e-30 41
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_005054.2598277.p0 Protein 2e-37 41
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD NC_014475.1.orf0.gen Protein 2e-37 41
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD AM180355.1.gene1830. Protein 8e-38 41
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD DQ212986.1.gene4.p01 Protein 3e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD VFG1563 Protein 9e-37 41
EUBELI_01854 YP_002931290.1 two-component system OmpR family response regulator ResD VFG1702 Protein 7e-37 41