Gene Information

Name : HDEF_1570 (HDEF_1570)
Accession : YP_002924333.1
Strain : Candidatus Hamiltonella defensa T5A
Genome accession: NC_012751
Putative virulence/resistance : Unknown
Product : ISHde3, transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 1428335 - 1428634 bp
Length : 300 bp
Strand : +
Note : COG2963

DNA sequence :
ATGTCTCAGCCAACATTTAAACCAGAATTGAAACGCGAAGTAGCCCATCTGGTTATCGAACAAAATTACCCGTTTCGTCA
AGGCAGTGAAGCCATGGGTGTGAGTATCAGCGCCCTCCGTGATGGGGTGAAGCGGGCAATGAGCGAAAAAAGAGGACAAA
CTATTTCCCAGGGTAAAACAATGACAGCAGACCAACAACGGATTCAAGAGCTGGAAGCCAGACTCCGCAAGGTTGAACGG
GAGAAAGATATCCTCAAAAAGGCTTCAGCTCTCTTAATGTCAGACTTTTACAATCGATAA

Protein sequence :
MSQPTFKPELKREVAHLVIEQNYPFRQGSEAMGVSISALRDGVKRAMSEKRGQTISQGKTMTADQQRIQELEARLRKVER
EKDILKKASALLMSDFYNR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 1e-16 53
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 2e-15 47
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 1e-15 47
unnamed AAC31483.1 L0004 Not tested LEE Protein 4e-14 45
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 6e-14 45
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 6e-14 45
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 4e-14 44
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 5e-11 43
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-13 42
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-13 42
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-11 42
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-11 42
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-11 42
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-11 42
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-11 42
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-11 42
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-11 42
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-11 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HDEF_1570 YP_002924333.1 ISHde3, transposase VFG0784 Protein 2e-14 45
HDEF_1570 YP_002924333.1 ISHde3, transposase VFG1553 Protein 2e-11 43
HDEF_1570 YP_002924333.1 ISHde3, transposase VFG1485 Protein 5e-14 42
HDEF_1570 YP_002924333.1 ISHde3, transposase VFG1123 Protein 4e-12 42