Gene Information

Name : KP1_4202 (KP1_4202)
Accession : YP_002920805.1
Strain : Klebsiella pneumoniae NTUH-K2044
Genome accession: NC_012731
Putative virulence/resistance : Resistance
Product : AraC family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 4035617 - 4035979 bp
Length : 363 bp
Strand : -
Note : internal ID: KP4202

DNA sequence :
ATGAACACTGGCGCCATCATTCAGGATCTGATTGACTGGATCGACAACCATCTTGATAGCCGTCTGGATATTGACACCGT
TGCCCGACGAGCCGGCTATTCGAAGTGGCACCTGCAGCGGATCTTCAAAGAACATACCGGGCAGCCCCTCGGAGAATATA
TTCGGGCGAAAAAGCTGCAAAAGTCGATCGAACGCTTGGCCCACAGCAACGAGCCGATCCTGAACGTGGCGATTGCCCTC
GGCTTTGACTCCCAGCAGTCCTTCAACCGCAGCTTCAAGCGCCAGTACGGCCAGGCGCCCGGCGTCTGGCGCCGGAGTAT
CAGCCGCTCTGTTGCGCAGACATCTCGTCAGCGATCCGCATGA

Protein sequence :
MNTGAIIQDLIDWIDNHLDSRLDIDTVARRAGYSKWHLQRIFKEHTGQPLGEYIRAKKLQKSIERLAHSNEPILNVAIAL
GFDSQQSFNRSFKRQYGQAPGVWRRSISRSVAQTSRQRSA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-24 46
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 8e-20 44
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 8e-20 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KP1_4202 YP_002920805.1 AraC family transcriptional regulator CP000647.1.gene4499. Protein 8e-26 48
KP1_4202 YP_002920805.1 AraC family transcriptional regulator NC_002695.1.914293.p Protein 5e-25 47
KP1_4202 YP_002920805.1 AraC family transcriptional regulator BAC0371 Protein 5e-25 47
KP1_4202 YP_002920805.1 AraC family transcriptional regulator CP000647.1.gene1624. Protein 5e-24 47
KP1_4202 YP_002920805.1 AraC family transcriptional regulator CP001918.1.gene2033. Protein 6e-24 47
KP1_4202 YP_002920805.1 AraC family transcriptional regulator CP000034.1.gene4505. Protein 1e-24 46
KP1_4202 YP_002920805.1 AraC family transcriptional regulator CP001138.1.gene4488. Protein 7e-25 46
KP1_4202 YP_002920805.1 AraC family transcriptional regulator CP001138.1.gene1637. Protein 1e-23 46
KP1_4202 YP_002920805.1 AraC family transcriptional regulator CP001918.1.gene327.p Protein 4e-25 45
KP1_4202 YP_002920805.1 AraC family transcriptional regulator BAC0560 Protein 8e-24 44
KP1_4202 YP_002920805.1 AraC family transcriptional regulator NC_002695.1.917339.p Protein 8e-24 44
KP1_4202 YP_002920805.1 AraC family transcriptional regulator CP000034.1.gene1596. Protein 7e-24 44
KP1_4202 YP_002920805.1 AraC family transcriptional regulator NC_010558.1.6276025. Protein 4e-20 44
KP1_4202 YP_002920805.1 AraC family transcriptional regulator CP001138.1.gene612.p Protein 2e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KP1_4202 YP_002920805.1 AraC family transcriptional regulator VFG0585 Protein 6e-25 46
KP1_4202 YP_002920805.1 AraC family transcriptional regulator VFG1038 Protein 3e-20 44