Gene Information

Name : soxS (KP1_0325)
Accession : YP_002917286.1
Strain : Klebsiella pneumoniae NTUH-K2044
Genome accession: NC_012731
Putative virulence/resistance : Resistance
Product : DNA-binding transcriptional regulator SoxS
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 336261 - 336590 bp
Length : 330 bp
Strand : -
Note : regulates genes involved in response to oxidative stress

DNA sequence :
ATGTCCCATCAGGATATTATTCAAACTTTGATTGAATGGATTGATGAACATATCGATCAACCACTTAACATTGATATAGT
CGCCAGAAAGTCAGGATACTCGAAGTGGTACCTGCAGCGGATGTTCCGTACCGTGATGCATCAGACGCTGGGGGACTATA
TTCGCCAGCGCCGCCTGCTGCTGGCGGCGGAAGCGTTGCGAACCACCCAGCGGCCGATCTTTGATATCGCCATGGATCTG
GGCTACGTCTCGCAGCAAACCTTCTCCCGGGTGTTCCGCCGCGAGTTTGACCGCACTCCCAGCGACTATCGCCATCAGAT
CTCCGCGTGA

Protein sequence :
MSHQDIIQTLIEWIDEHIDQPLNIDIVARKSGYSKWYLQRMFRTVMHQTLGDYIRQRRLLLAAEALRTTQRPIFDIAMDL
GYVSQQTFSRVFRREFDRTPSDYRHQISA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-35 91
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 1e-14 47
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 1e-14 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_002917286.1 DNA-binding transcriptional regulator SoxS CP000647.1.gene4499. Protein 2e-38 100
soxS YP_002917286.1 DNA-binding transcriptional regulator SoxS CP001918.1.gene327.p Protein 3e-37 93
soxS YP_002917286.1 DNA-binding transcriptional regulator SoxS CP001138.1.gene4488. Protein 6e-36 91
soxS YP_002917286.1 DNA-binding transcriptional regulator SoxS BAC0371 Protein 5e-35 89
soxS YP_002917286.1 DNA-binding transcriptional regulator SoxS NC_002695.1.914293.p Protein 5e-35 89
soxS YP_002917286.1 DNA-binding transcriptional regulator SoxS CP000034.1.gene4505. Protein 9e-35 88
soxS YP_002917286.1 DNA-binding transcriptional regulator SoxS CP001138.1.gene612.p Protein 1e-18 49
soxS YP_002917286.1 DNA-binding transcriptional regulator SoxS NC_010558.1.6276025. Protein 6e-15 47
soxS YP_002917286.1 DNA-binding transcriptional regulator SoxS CP000647.1.gene1624. Protein 1e-15 42
soxS YP_002917286.1 DNA-binding transcriptional regulator SoxS CP001918.1.gene2033. Protein 8e-16 42
soxS YP_002917286.1 DNA-binding transcriptional regulator SoxS CP001138.1.gene1637. Protein 7e-16 41
soxS YP_002917286.1 DNA-binding transcriptional regulator SoxS BAC0560 Protein 6e-16 41
soxS YP_002917286.1 DNA-binding transcriptional regulator SoxS NC_002695.1.917339.p Protein 6e-16 41
soxS YP_002917286.1 DNA-binding transcriptional regulator SoxS CP000034.1.gene1596. Protein 6e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_002917286.1 DNA-binding transcriptional regulator SoxS VFG0585 Protein 6e-36 91
soxS YP_002917286.1 DNA-binding transcriptional regulator SoxS VFG1038 Protein 5e-15 47