Gene Information

Name : KP1_1492 (KP1_1492)
Accession : YP_002918316.1
Strain : Klebsiella pneumoniae NTUH-K2044
Genome accession: NC_012731
Putative virulence/resistance : Resistance
Product : putative regulatory protein
Function : -
COG functional category : K : Transcription
COG ID : COG4977
EC number : -
Position : 1432166 - 1432507 bp
Length : 342 bp
Strand : +
Note : internal ID: KP1492

DNA sequence :
ATGACGATTTCCGCTCAGGTGATTGATACTATCGTCGAGTGGATTGATGATAACCTGCATCAACCGCTGCGTATTGATGA
TATCGCTCGCCATGCCGGGTATTCGAAATGGCATCTGCAACGGCTGTTTTTACAGTACAAAGGGGAGAGCCTGGGGCGCT
ATATTCGCGAAAGGAAGCTGCTGCTGGCCGCCCGCGATCTGCGCGACACCGATCAGCGGGTCTACGATATCTGCCTCAAG
TATGGCTTTGATTCGCAACAGACTTTTACCCGCGTCTTTACCCGGACCTTCAATCAGCCGCCGGGCGCCTACCGCAAAGA
GAACCACAGTCGCGCCCACTGA

Protein sequence :
MTISAQVIDTIVEWIDDNLHQPLRIDDIARHAGYSKWHLQRLFLQYKGESLGRYIRERKLLLAARDLRDTDQRVYDICLK
YGFDSQQTFTRVFTRTFNQPPGAYRKENHSRAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 1e-15 52
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 5e-14 48
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 5e-14 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KP1_1492 YP_002918316.1 putative regulatory protein CP001138.1.gene612.p Protein 3e-36 92
KP1_1492 YP_002918316.1 putative regulatory protein CP001138.1.gene4488. Protein 4e-16 52
KP1_1492 YP_002918316.1 putative regulatory protein CP001918.1.gene327.p Protein 4e-16 51
KP1_1492 YP_002918316.1 putative regulatory protein CP000647.1.gene4499. Protein 5e-16 51
KP1_1492 YP_002918316.1 putative regulatory protein NC_002695.1.914293.p Protein 5e-15 49
KP1_1492 YP_002918316.1 putative regulatory protein BAC0371 Protein 5e-15 49
KP1_1492 YP_002918316.1 putative regulatory protein CP000034.1.gene4505. Protein 9e-15 48
KP1_1492 YP_002918316.1 putative regulatory protein NC_010558.1.6276025. Protein 2e-14 48
KP1_1492 YP_002918316.1 putative regulatory protein CP000647.1.gene1624. Protein 3e-15 47
KP1_1492 YP_002918316.1 putative regulatory protein CP001918.1.gene2033. Protein 2e-15 46
KP1_1492 YP_002918316.1 putative regulatory protein CP001138.1.gene1637. Protein 1e-15 45
KP1_1492 YP_002918316.1 putative regulatory protein NC_002695.1.917339.p Protein 5e-16 44
KP1_1492 YP_002918316.1 putative regulatory protein BAC0560 Protein 5e-16 44
KP1_1492 YP_002918316.1 putative regulatory protein CP000034.1.gene1596. Protein 5e-16 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KP1_1492 YP_002918316.1 putative regulatory protein VFG0585 Protein 4e-16 52
KP1_1492 YP_002918316.1 putative regulatory protein VFG1038 Protein 2e-14 48