Gene Information

Name : bglu_1g34340 (bglu_1g34340)
Accession : YP_002913196.1
Strain :
Genome accession: NC_012724
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 3899839 - 3900156 bp
Length : 318 bp
Strand : -
Note : -

DNA sequence :
ATGCTCGCCATGGAGAGGTGTCTGATGCCGAAGCAACGTCGCTCGTTTTCCCCCGAGTTCAAACAGCAAGCAGCCAGCCT
GGTGCTTGACCAGGGCTATAACTTTTCAGAGGCGAGCCGTTCGGTCGGCGTCGGCGAGACGGTGCTGCGCCGCTGGGTGC
AGCAACTTCAGATGGAACGCCAGGGCGTCACGCCGCAGGGCAAGGCAATCACGCCGGATCAACAGCGTATTCAGCAACTC
GAGGCGCGTATCGAACGCCTCGAGCGTGAGAAGGCCATTTTAAGAGGCCAGTTCAAAAACCCTGCTCAGCTCGTCTGA

Protein sequence :
MLAMERCLMPKQRRSFSPEFKQQAASLVLDQGYNFSEASRSVGVGETVLRRWVQQLQMERQGVTPQGKAITPDQQRIQQL
EARIERLEREKAILRGQFKNPAQLV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-27 69
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-19 50
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 3e-19 50
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 5e-19 49
unnamed AAC31483.1 L0004 Not tested LEE Protein 3e-19 49
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 5e-19 49
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 5e-19 49
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 7e-17 47
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-16 46
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-16 46
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-16 46
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-16 46
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-16 46
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-16 46
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-16 46
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-16 46
api80 CAF28554.1 putative transposase Not tested YAPI Protein 5e-16 43
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-16 43
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-16 43
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-15 42
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 3e-10 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bglu_1g34340 YP_002913196.1 transposase VFG0784 Protein 1e-19 49
bglu_1g34340 YP_002913196.1 transposase VFG1553 Protein 3e-17 47
bglu_1g34340 YP_002913196.1 transposase VFG1123 Protein 7e-17 46
bglu_1g34340 YP_002913196.1 transposase VFG1485 Protein 5e-17 43
bglu_1g34340 YP_002913196.1 transposase VFG1566 Protein 1e-10 41