Gene Information

Name : bglu_2g15360 (bglu_2g15360)
Accession : YP_002909125.1
Strain :
Genome accession: NC_012721
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1945223 - 1945957 bp
Length : 735 bp
Strand : -
Note : -

DNA sequence :
ATGGACTCACTGAAACGCATCCTGATCGTCGAAGACGATGCCGACATCGCGAACGTGCTCGCGCTGCACCTGCGCGACGA
GCGCTACGAGGTGGTCCACTGCGCGAACGGCGACGACGGCCTGCGGCGCCTGGAGCAGGGCGGCTGGGACGCGCTGATCC
TGGACCTGATGCTGCCCGGCGTGGACGGCCTCGAGATCTGCCGGCGCGCACGCGCGATGGCGCGCTACACGCCGATCATC
ATCATCAGCGCGCGCTCGAGCGAGGTGCACCGGATTCTCGGCCTCGAGCTCGGCGCCGACGATTACCTTGCCAAGCCGTT
CTCGATGCTGGAGCTGGTGGCGCGCGTGAAGGCGCTGCTGCGGCGCGTCGAGGCGCTCTCGCGCGACACGCGCGCCGAGG
CCGGGCGCGTGGAGGTGGGCGGCCTGAGGCTCGATCCGCTCACGCGCGAGGCCGCCGTGGACGGCGCCGCGATCGACCTG
ACGCCGCGCGAATTCGACCTGCTCTATCACTTCGCGCGCCATCCCGGCAAGGCGTTCTCGCGCACCGATCTGCTCAACGC
CGTATGGGGCTATCAGCACGAGGGCTACGAGCACACCGTGAACACCCACATCAACCGGCTGCGCGCCAAGATCGAGGCCG
ACCCGGCGCAGCCGGCGCGCATCCTGACGGTCTGGGGCCGCGGCTACAAGCTGGTCGCGCCGGGGCCGGCGGCCGGCGCG
GGCCGCGAGGCATGA

Protein sequence :
MDSLKRILIVEDDADIANVLALHLRDERYEVVHCANGDDGLRRLEQGGWDALILDLMLPGVDGLEICRRARAMARYTPII
IISARSSEVHRILGLELGADDYLAKPFSMLELVARVKALLRRVEALSRDTRAEAGRVEVGGLRLDPLTREAAVDGAAIDL
TPREFDLLYHFARHPGKAFSRTDLLNAVWGYQHEGYEHTVNTHINRLRAKIEADPAQPARILTVWGRGYKLVAPGPAAGA
GREA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-67 61
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-66 61

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bglu_2g15360 YP_002909125.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-45 45
bglu_2g15360 YP_002909125.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-41 42
bglu_2g15360 YP_002909125.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 6e-37 42
bglu_2g15360 YP_002909125.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 5e-39 42
bglu_2g15360 YP_002909125.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-36 41
bglu_2g15360 YP_002909125.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-36 41
bglu_2g15360 YP_002909125.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-36 41
bglu_2g15360 YP_002909125.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-36 41
bglu_2g15360 YP_002909125.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-36 41
bglu_2g15360 YP_002909125.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-36 41
bglu_2g15360 YP_002909125.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-36 41
bglu_2g15360 YP_002909125.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-36 41
bglu_2g15360 YP_002909125.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-32 41
bglu_2g15360 YP_002909125.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bglu_2g15360 YP_002909125.1 winged helix family two component transcriptional regulator VFG1563 Protein 5e-67 61
bglu_2g15360 YP_002909125.1 winged helix family two component transcriptional regulator VFG1702 Protein 5e-67 61
bglu_2g15360 YP_002909125.1 winged helix family two component transcriptional regulator VFG1389 Protein 4e-31 43