Gene Information

Name : bglu_2p0800 (bglu_2p0800)
Accession : YP_002907589.1
Strain :
Genome accession: NC_012718
Putative virulence/resistance : Resistance
Product : Hg(II)-responsive transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 105730 - 106140 bp
Length : 411 bp
Strand : +
Note : -

DNA sequence :
ATGACGAACGAAGAAACGGGAAATCTGACGATCGGCGGCTTTGCCAAGGCGGCCGGCGTCAATGTCGAGACGATTCGCTT
TTACCAACAAAGGGGTTTGCTGCGTACGCCGGGCCGACCGCTTGGCGGGATTCGCCGCTACGGCGAATCCGATGTCGCAC
GGATGAGATTCGTCAAGGCGGCGCAGCGGCTAGGCTTCAGCCTGGACGAAGTAGGGCAGCTTCTGCGGCTGGATGACGGT
ACGCATTGTGGCGAAGCGGCGGAACTGGCGGCCCGGCATCTCGTCGACGTGCGAGCCAAGCTCGACGATCTCGCACGCAT
TGAAGCGGCGCTTTCCCATCTCGTGAGCGAGTGCCGCACGCGCCGCGGCAACGTGTCTTGTCCATTGATCGCCGCGCTAC
ATGACCGATAG

Protein sequence :
MTNEETGNLTIGGFAKAAGVNVETIRFYQQRGLLRTPGRPLGGIRRYGESDVARMRFVKAAQRLGFSLDEVGQLLRLDDG
THCGEAAELAARHLVDVRAKLDDLARIEAALSHLVSECRTRRGNVSCPLIAALHDR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 2e-35 72
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 8e-36 72
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 5e-36 72
merR ACK44535.1 MerR Not tested SGI1 Protein 3e-35 68
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 3e-35 68
merR AFG30124.1 MerR Not tested PAGI-2 Protein 3e-35 68
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 5e-35 68
merR AGK07025.1 MerR Not tested SGI1 Protein 1e-34 67
merR AGK07083.1 MerR Not tested SGI1 Protein 1e-34 67
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 8e-34 66
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 4e-18 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bglu_2p0800 YP_002907589.1 Hg(II)-responsive transcriptional regulator BAC0686 Protein 2e-35 71
bglu_2p0800 YP_002907589.1 Hg(II)-responsive transcriptional regulator BAC0687 Protein 4e-36 69
bglu_2p0800 YP_002907589.1 Hg(II)-responsive transcriptional regulator BAC0232 Protein 4e-36 69
bglu_2p0800 YP_002907589.1 Hg(II)-responsive transcriptional regulator BAC0689 Protein 2e-34 69
bglu_2p0800 YP_002907589.1 Hg(II)-responsive transcriptional regulator BAC0688 Protein 2e-36 68
bglu_2p0800 YP_002907589.1 Hg(II)-responsive transcriptional regulator BAC0683 Protein 1e-35 68
bglu_2p0800 YP_002907589.1 Hg(II)-responsive transcriptional regulator BAC0684 Protein 1e-35 68