|
Name : GBP346_A2065 (GBP346_A2065) Accession : YP_002896768.1 Strain : Burkholderia pseudomallei MSHR346 Genome accession: NC_012695 Putative virulence/resistance : Unknown Product : isrso10-transposase orfb protein Function : - COG functional category : - COG ID : - EC number : - Position : 2039150 - 2039338 bp Length : 189 bp Strand : + Note : an automated process has identified a potential problem with this gene model; the current end5 and/or the end3 may need to extended or the current gene model may need to be merged with a neighboring gene model; the current gene model (or a revised gene mo DNA sequence : GTGGCGAAGAGCTTCGTGACGATGAAGCGTGACTATGTCGCCTTCATGTCGAAACTAAATGCGACCACCGCAGTGCGTCA TCCTGCCGACGCGTTCGAACACTACAACGACCAGTGTCATCACGGCGCACTGCAATATCGCTCGCCATGCGAAATCCGAC GCAGAACCGACTCATCAACTCGTGTGTGA Protein sequence : MAKSFVTMKRDYVAFMSKLNATTAVRHPADAFEHYNDQCHHGALQYRSPCEIRRRTDSSTRV |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| c5198 | NP_757046.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 2e-07 | 60 |
