
|
Name : GBP346_A1854 (GBP346_A1854) Accession : YP_002896560.1 Strain : Burkholderia pseudomallei MSHR346 Genome accession: NC_012695 Putative virulence/resistance : Virulence Product : quaternary ammonium compound-resistance protein QacE Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2076 EC number : - Position : 1802209 - 1802547 bp Length : 339 bp Strand : + Note : identified by match to protein family HMM PF00893 DNA sequence : ATGCAACTTCCAGGTTACGCATGGCTCGCGATCGCGATCGTCGCCGAGGTGGTCGGCACGTCGGCGCTGCGCGCGGCCGA AGGTTTCACGCGGCTCTGGCCGACGCTCGTCGTCGCCCTCGGCTACGGCACCGCGTTCTACTGCCTGTCGCTCACGCTCA AGAGCATGCCCGTCGGCATCGTGTACGCGATCTGGTCGGGCGCGGGCATCGTGCTCATCACGCTCGTCGCGCTCGTGCTC TATCGGCAGGTGCCGGACTGGCCCGCGGTCGTCGGGCTCGCGCTCATCGTCGCGGGCGTCGTGGTGCTCAATCTCTTTTC GAAAATGCAGGCGCATTGA Protein sequence : MQLPGYAWLAIAIVAEVVGTSALRAAEGFTRLWPTLVVALGYGTAFYCLSLTLKSMPVGIVYAIWSGAGIVLITLVALVL YRQVPDWPAVVGLALIVAGVVVLNLFSKMQAH |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | CAD42067.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 8e-17 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| GBP346_A1854 | YP_002896560.1 | quaternary ammonium compound-resistance protein QacE | BAC0377 | Protein | 8e-22 | 60 |
| GBP346_A1854 | YP_002896560.1 | quaternary ammonium compound-resistance protein QacE | BAC0322 | Protein | 2e-15 | 58 |
| GBP346_A1854 | YP_002896560.1 | quaternary ammonium compound-resistance protein QacE | NC_010410.6003348.p0 | Protein | 4e-16 | 55 |
| GBP346_A1854 | YP_002896560.1 | quaternary ammonium compound-resistance protein QacE | BAC0002 | Protein | 4e-16 | 55 |
| GBP346_A1854 | YP_002896560.1 | quaternary ammonium compound-resistance protein QacE | CP004022.1.gene1549. | Protein | 2e-15 | 50 |
| GBP346_A1854 | YP_002896560.1 | quaternary ammonium compound-resistance protein QacE | CP001138.1.gene1489. | Protein | 7e-14 | 50 |
| GBP346_A1854 | YP_002896560.1 | quaternary ammonium compound-resistance protein QacE | AE000516.2.gene3301. | Protein | 6e-10 | 50 |
| GBP346_A1854 | YP_002896560.1 | quaternary ammonium compound-resistance protein QacE | BAC0249 | Protein | 6e-10 | 50 |
| GBP346_A1854 | YP_002896560.1 | quaternary ammonium compound-resistance protein QacE | NC_002695.1.913273.p | Protein | 5e-12 | 49 |
| GBP346_A1854 | YP_002896560.1 | quaternary ammonium compound-resistance protein QacE | BAC0150 | Protein | 5e-12 | 47 |
| GBP346_A1854 | YP_002896560.1 | quaternary ammonium compound-resistance protein QacE | BAC0327 | Protein | 2e-16 | 47 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| GBP346_A1854 | YP_002896560.1 | quaternary ammonium compound-resistance protein QacE | VFG1586 | Protein | 3e-17 | 41 |