Gene Information

Name : GBP346_A1854 (GBP346_A1854)
Accession : YP_002896560.1
Strain : Burkholderia pseudomallei MSHR346
Genome accession: NC_012695
Putative virulence/resistance : Virulence
Product : quaternary ammonium compound-resistance protein QacE
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 1802209 - 1802547 bp
Length : 339 bp
Strand : +
Note : identified by match to protein family HMM PF00893

DNA sequence : 
ATGCAACTTCCAGGTTACGCATGGCTCGCGATCGCGATCGTCGCCGAGGTGGTCGGCACGTCGGCGCTGCGCGCGGCCGA
AGGTTTCACGCGGCTCTGGCCGACGCTCGTCGTCGCCCTCGGCTACGGCACCGCGTTCTACTGCCTGTCGCTCACGCTCA
AGAGCATGCCCGTCGGCATCGTGTACGCGATCTGGTCGGGCGCGGGCATCGTGCTCATCACGCTCGTCGCGCTCGTGCTC
TATCGGCAGGTGCCGGACTGGCCCGCGGTCGTCGGGCTCGCGCTCATCGTCGCGGGCGTCGTGGTGCTCAATCTCTTTTC
GAAAATGCAGGCGCATTGA

Protein sequence : 
MQLPGYAWLAIAIVAEVVGTSALRAAEGFTRLWPTLVVALGYGTAFYCLSLTLKSMPVGIVYAIWSGAGIVLITLVALVL
YRQVPDWPAVVGLALIVAGVVVLNLFSKMQAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 8e-17 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GBP346_A1854 YP_002896560.1 quaternary ammonium compound-resistance protein QacE BAC0377 Protein 8e-22 60
GBP346_A1854 YP_002896560.1 quaternary ammonium compound-resistance protein QacE BAC0322 Protein 2e-15 58
GBP346_A1854 YP_002896560.1 quaternary ammonium compound-resistance protein QacE NC_010410.6003348.p0 Protein 4e-16 55
GBP346_A1854 YP_002896560.1 quaternary ammonium compound-resistance protein QacE BAC0002 Protein 4e-16 55
GBP346_A1854 YP_002896560.1 quaternary ammonium compound-resistance protein QacE CP004022.1.gene1549. Protein 2e-15 50
GBP346_A1854 YP_002896560.1 quaternary ammonium compound-resistance protein QacE CP001138.1.gene1489. Protein 7e-14 50
GBP346_A1854 YP_002896560.1 quaternary ammonium compound-resistance protein QacE AE000516.2.gene3301. Protein 6e-10 50
GBP346_A1854 YP_002896560.1 quaternary ammonium compound-resistance protein QacE BAC0249 Protein 6e-10 50
GBP346_A1854 YP_002896560.1 quaternary ammonium compound-resistance protein QacE NC_002695.1.913273.p Protein 5e-12 49
GBP346_A1854 YP_002896560.1 quaternary ammonium compound-resistance protein QacE BAC0150 Protein 5e-12 47
GBP346_A1854 YP_002896560.1 quaternary ammonium compound-resistance protein QacE BAC0327 Protein 2e-16 47

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GBP346_A1854 YP_002896560.1 quaternary ammonium compound-resistance protein QacE VFG1586 Protein 3e-17 41