|
Name : GBP346_A1636 (GBP346_A1636) Accession : YP_002896347.1 Strain : Burkholderia pseudomallei MSHR346 Genome accession: NC_012695 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 1579686 - 1579841 bp Length : 156 bp Strand : + Note : an automated process has identified a potential problem with this gene model; the current end5 and/or the end3 may need to extended or the current gene model may need to be merged with a neighboring gene model; the current gene model (or a revised gene mo DNA sequence : ATGATGTTGCAACGACGGCCAGCAGGTCATGCCGTGAGGACGAGCAAGTTTACCGAAGAGCAGATCGCATACGCTTTGAA GCAGGCCGAGCTGGGCACGCCCGTCGCGGAGGTATGCCGCAAGATGGGAAGCAGCGACAGGACGTTTTACAACTGA Protein sequence : MMLQRRPAGHAVRTSKFTEEQIAYALKQAELGTPVAEVCRKMGSSDRTFYN |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | ACJ13534.1 | hypothetical protein | Not tested | KpGI-1 | Protein | 6e-07 | 61 |
