|
Name : rpmG (Tola_0181) Accession : YP_002891397.1 Strain : Tolumonas auensis DSM 9187 Genome accession: NC_012691 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L33 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0267 EC number : - Position : 196801 - 196968 bp Length : 168 bp Strand : - Note : in Escherichia coli BM108, a mutation that results in lack of L33 synthesis had no effect on ribosome synthesis or function; there are paralogous genes in several bacterial genomes, and a CXXC motif for zinc binding and an upstream regulation region of th DNA sequence : ATGGCTAAAGGTGCTCGCGAAAAAATTCGTCTGAACTCCAGCGCCGGTACTGGTCACTTCTACACTACGACCAAGAACAA GCGCACCATGCCTGAGAAAATGGAGATCAAAAAATTTGATCCTGTTGTTCGTCAGCATGTAATTTACAAGGAAGGCAAGA TCAAGTAA Protein sequence : MAKGAREKIRLNSSAGTGHFYTTTKNKRTMPEKMEIKKFDPVVRQHVIYKEGKIK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmG | NP_814353.1 | 50S ribosomal protein L33 | Not tested | Not named | Protein | 4e-06 | 42 |
| ef0106 | AAM75309.1 | EF0106 | Not tested | Not named | Protein | 3e-06 | 42 |
