Gene Information

Name : EAT1b_1752 (EAT1b_1752)
Accession : YP_002886123.1
Strain : Exiguobacterium sp. AT1b
Genome accession: NC_012673
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1720146 - 1720856 bp
Length : 711 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bsu:BSU40410 hypothetical protein

DNA sequence :
ATGGATCGTACGATTTTAGTGGTAGATGACGAACAACCAATCGCAGATATATTGAAGTTTAAACTTGAAAAAGAAGGTTA
CCAGGTGCATGTCGCCTATGACGGCGAAGAAGCGCTCGTCAAAGTAGAAGAGATTCAACCGGATCTCATCTTGCTCGACA
TCATGCTTCCGCTCAAAGACGGCATGGAAGTATGCCGTGAGGTACGGAAGAAGTATGACATGCCGATCATCATGTTGACG
GCGAAAGATTCCGAGATTGACAAAGTACTCGGACTAGAGCTCGGTGCAGACGATTACGTCACAAAGCCGTTCAGCTCACG
TGAATTGTTAGCCCGTGTCAAAGCGAACATGCGACGTCATGCGACAGCACCGGCGCCAGAAGCAAAAGGAGCCAACGCGA
ACGATATCGTGATCGGCGACTTGACGATTCATCCGGATTCGTACATGGTGACGAAACGGGATGAGAAAATCGAATTGACG
CATCGCGAGTTCGAATTGATTCATTACCTCGCCCAAAACATCGGGCAAGTGATGACGCGGGAGCACTTGCTCCAAACGGT
GTGGGGCTATGATTACTTCGGTGATGTGCGTACTGTGGACGTCACGGTGCGTCGTCTTCGTGAAAAAGTAGAGGACAACC
CGTCGACTCCGACGTATATTATTACGCGTCGCGGCGTCGGGTATTATTTGAAGGCAGGAGAAGAAGATTAA

Protein sequence :
MDRTILVVDDEQPIADILKFKLEKEGYQVHVAYDGEEALVKVEEIQPDLILLDIMLPLKDGMEVCREVRKKYDMPIIMLT
AKDSEIDKVLGLELGADDYVTKPFSSRELLARVKANMRRHATAPAPEAKGANANDIVIGDLTIHPDSYMVTKRDEKIELT
HREFELIHYLAQNIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKVEDNPSTPTYIITRRGVGYYLKAGEED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-22 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 1e-56 63
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 3e-48 56
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 4e-48 55
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 4e-48 55
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 4e-48 55
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 4e-48 55
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 4e-48 55
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 4e-48 55
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 4e-48 55
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-48 55
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 4e-48 55
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 3e-39 51
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 2e-38 48
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 7e-31 48
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 3e-39 47
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 8e-31 46
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family CP004022.1.gene3215. Protein 1e-30 46
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 9e-32 45
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family CP000034.1.gene3834. Protein 3e-28 44
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 2e-28 44
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family BAC0533 Protein 7e-29 44
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_002695.1.915041.p Protein 3e-28 44
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family CP000647.1.gene4257. Protein 7e-29 44
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-29 43
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-29 43
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-29 43
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-29 43
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-29 43
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-29 43
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-29 43
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-29 43
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 9e-33 42
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 9e-33 42
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family AF130997.1.orf0.gene Protein 4e-31 42
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 5e-33 42
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family BAC0308 Protein 1e-19 41
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family AF310956.2.orf0.gene Protein 1e-22 41
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 3e-24 41
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 4e-30 41
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 6e-32 41
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 8e-25 41
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 3e-23 41
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family BAC0039 Protein 7e-24 41
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 4e-24 41
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 7e-24 41
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 6e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EAT1b_1752 YP_002886123.1 two component transcriptional regulator, winged helix family VFG1390 Protein 2e-29 42