Gene Information

Name : Bcav_3086 (Bcav_3086)
Accession : YP_002883092.1
Strain : Beutenbergia cavernae DSM 12333
Genome accession: NC_012669
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3441674 - 3442375 bp
Length : 702 bp
Strand : +
Note : PFAM: Transcriptional regulatory protein, C terminal; Response regulator receiver domain

DNA sequence :
ATGCTCCCGGACGAGCTCGCCGGCCGGAGGGTGCTCATCGTCGACGACGACGATGCCCTCGTCGGCGTGCTCGCCGAGTA
CCTCCGTGCGGCGGGATTCGTGACGTCGGTCGCCGGGGACGGCCTGGGCGCCGTCGAGCGGACCCGCAGCTGGGAGCCGG
ACCTGATCGTGCTCGACCGCATGCTTCCCGGCATCGACGGCCTCGAGGTGACCCGCCGCGTCCGGGCCATCTGCGACGCC
CCGATCATCATGCTCACCGCGCTCGGCACCGGCGACGACCGCATCGCCGGCCTGGAGGTCGGCGCCGACGACTACGTCAC
CAAGCCCTTCTCGCCGCGGGAGCTCGTGCTGCGCATCCAGTCCGTGCTCCGGCGGGCGCTCGGCCCGCTGAGCGCGCCGA
GCGACGCGACCGCGGGGCCGCTCGACCTCGACGGCGCCCGCCGCCGCGTGACGCGCGACGGCGACGTCGTCCCGCTCACG
ACCCGCGAGTTCGACCTCCTCGCGTTCCTCATGCGCCATCCCGATCGCGCCTTCAGCCGCGAGGAGCTGCTCGAGCACGT
CTGGGGCTGGACGTTCGGCGACCTGTCGACGGTCACCGTCCACGTGCGCCGCCTCCGCGCCAAGATCGAGGACGACCCCA
CCCGGCCGCGGATCGTGCAGACGGTCTGGGGCGTCGGCTACCTCCTGCGGAGCGAGCCGTGA

Protein sequence :
MLPDELAGRRVLIVDDDDALVGVLAEYLRAAGFVTSVAGDGLGAVERTRSWEPDLIVLDRMLPGIDGLEVTRRVRAICDA
PIIMLTALGTGDDRIAGLEVGADDYVTKPFSPRELVLRIQSVLRRALGPLSAPSDATAGPLDLDGARRRVTRDGDVVPLT
TREFDLLAFLMRHPDRAFSREELLEHVWGWTFGDLSTVTVHVRRLRAKIEDDPTRPRIVQTVWGVGYLLRSEP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-30 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcav_3086 YP_002883092.1 two component transcriptional regulator AE000516.2.gene3505. Protein 7e-36 46
Bcav_3086 YP_002883092.1 two component transcriptional regulator HE999704.1.gene2815. Protein 6e-37 45
Bcav_3086 YP_002883092.1 two component transcriptional regulator BAC0197 Protein 3e-32 44
Bcav_3086 YP_002883092.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-37 43
Bcav_3086 YP_002883092.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-37 43
Bcav_3086 YP_002883092.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-37 43
Bcav_3086 YP_002883092.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-37 43
Bcav_3086 YP_002883092.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-37 43
Bcav_3086 YP_002883092.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-37 43
Bcav_3086 YP_002883092.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-37 43
Bcav_3086 YP_002883092.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-37 43
Bcav_3086 YP_002883092.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-37 43
Bcav_3086 YP_002883092.1 two component transcriptional regulator BAC0111 Protein 3e-36 42
Bcav_3086 YP_002883092.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-37 42
Bcav_3086 YP_002883092.1 two component transcriptional regulator CP000034.1.gene3671. Protein 6e-38 42
Bcav_3086 YP_002883092.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-37 42
Bcav_3086 YP_002883092.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-34 42
Bcav_3086 YP_002883092.1 two component transcriptional regulator NC_008702.1.4607594. Protein 2e-29 42
Bcav_3086 YP_002883092.1 two component transcriptional regulator HE999704.1.gene1528. Protein 4e-28 41
Bcav_3086 YP_002883092.1 two component transcriptional regulator BAC0083 Protein 1e-32 41
Bcav_3086 YP_002883092.1 two component transcriptional regulator BAC0347 Protein 3e-33 41
Bcav_3086 YP_002883092.1 two component transcriptional regulator U82965.2.orf14.gene. Protein 6e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcav_3086 YP_002883092.1 two component transcriptional regulator VFG1389 Protein 1e-31 45
Bcav_3086 YP_002883092.1 two component transcriptional regulator VFG1390 Protein 4e-30 43
Bcav_3086 YP_002883092.1 two component transcriptional regulator VFG1563 Protein 2e-30 41
Bcav_3086 YP_002883092.1 two component transcriptional regulator VFG1702 Protein 7e-30 41
Bcav_3086 YP_002883092.1 two component transcriptional regulator VFG1386 Protein 5e-30 41