Gene Information

Name : VCD_003501 (VCD_003501)
Accession : YP_002879229.1
Strain :
Genome accession: NC_012668
Putative virulence/resistance : Virulence
Product : toxin co-regulated pilus biosynthesis protein H transcriptional activator of ToxT promoter
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2773898 - 2774308 bp
Length : 411 bp
Strand : -
Note : -

DNA sequence :
ATGCACAAAAAATTAAAAGCTTGGGGGGGCGCTACAGGTCTATTCGTTGTAGCACTTGGTGTAACGATCATCGCACTCCC
GATGCGACAAAAAAACTCGCACGGCACAATGATTATTGATGGTACAGTCACACAAATTTTTTCTACTTATCAAGGTAATC
TATCCAATGTTTGGCTTACCCAGACCGATCCACAAGGTAACGTAGTCAAAAGTTGGACTACACGTTATCAAACATTGCCA
GATCCTAGCTCTCAGAAGCTAAATTTGATTCCCGACTACTCACAAAGTAATGCTAGCCGTGATTACAATGTGTTGAGTAT
TTATCAACTCGGCAAAGGTTGTTTTCTCGCCTTCCCTTACAAGCTGCTAACGGCTGAAAAAATGTGGTTTTCCTGTCAAA
GCGATTTTTAG

Protein sequence :
MHKKLKAWGGATGLFVVALGVTIIALPMRQKNSHGTMIIDGTVTQIFSTYQGNLSNVWLTQTDPQGNVVKSWTTRYQTLP
DPSSQKLNLIPDYSQSNASRDYNVLSIYQLGKGCFLAFPYKLLTAEKMWFSCQSDF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VC0827 NP_230475.1 toxin co-regulated pilus biosynthesis protein H Virulence VPI-1 Protein 8e-60 100
tcpH AAK20784.1 toxin-coregulated pilus biosynthesis protein H Virulence VPI Protein 6e-60 100
tcpH ACK75640.1 toxin co-regulated pilus biosynthesis protein H Virulence VPI Protein 6e-60 100
tcpH ACK75600.1 toxin co-regulated pilus biosynthesis protein H Virulence VPI Protein 2e-59 99
tcpH ACK75615.1 toxin co-regulated pilus biosynthesis protein H Virulence VPI Protein 1e-59 99
tcpH ACK75635.1 toxin co-regulated pilus biosynthesis protein H Virulence VPI Protein 1e-58 98
tcpH ACK75620.1 toxin co-regulated pilus biosynthesis protein H Virulence VPI Protein 7e-59 98
tcpH ACK75630.1 toxin co-regulated pilus biosynthesis protein H Virulence VPI Protein 2e-58 97
tcpH YP_001216308.1 toxin co-regulated pilus biosynthesis protein H Virulence VPI-1 Protein 3e-58 97
tcpH ACK75610.1 toxin co-regulated pilus biosynthesis protein H Virulence VPI Protein 3e-58 97
tcpH AAK20754.1 toxin-coregulated pilus biosynthesis protein H Virulence VPI Protein 2e-58 97
tcpH CAA45454.1 - Virulence VPI Protein 5e-54 97
tcpH ACK75625.1 toxin co-regulated pilus biosynthesis protein H Virulence VPI Protein 1e-57 96
tcpH ACK75605.1 toxin co-regulated pilus biosynthesis protein H Virulence VPI Protein 1e-57 94

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VCD_003501 YP_002879229.1 toxin co-regulated pilus biosynthesis protein H transcriptional activator of ToxT promoter VFG0090 Protein 2e-60 100