Gene Information

Name : czcR (PFLU0701)
Accession : YP_002870368.1
Strain : Pseudomonas fluorescens SBW25
Genome accession: NC_012660
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 803500 - 804174 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence :
ATGCGTATCCTTGTGGTTGAGGACGAGCAGAAAACCGCCGACTACCTGCAGCAAGGCTTGACCGAAAGCGGTTATGTCGT
CGATTGCGCGGCCAGCGGCATTGATGGCCTGCACCTGGCCCGGCAACACCGCTACGAATTGGTGATCCTGGATGTCAACT
TGCCCAACACCGACGGCTGGGAAGTGCTGGAACAACTGCGCCGCGACGGCAACCAGCGCGTGATGATGCTGACCGCGCGC
GGCCGGCTGGCCGACAAGATCAAGGGCCTGGACATGGGCGCCGATGATTACCTGGTCAAGCCCTTCGAGTTTCCCGAGCT
GCTGGCCCGAGTGCGCACCCTGTTGCGACGCAGCGAACACATCCCAGTGCCGGACGTCCTGCGCGTCTCGGACCTGGAAC
TGGACCCGCGCCGGCATCGCGCCTATCGCGGCGACCGCCGGATCGACCTGACCACCAAGGAATTCGCGCTGCTGCACGTG
CTGATGCGCCAGGCCGGTGAAGTGATGACCCGCACGCAGATTATTTCGCTGGTGTGGGACATGAACTTCGACTGCGACAC
CAACGTCGTGGAAGTCTCGATCAGCCGTCTGCGGGGCAAGGTCGATGACCAGAGCGAGGTGAAGTTGATCCACACCATTC
GCGGCGTGGGTTACGTGCTGGAGGCGCGCCCATGA

Protein sequence :
MRILVVEDEQKTADYLQQGLTESGYVVDCAASGIDGLHLARQHRYELVILDVNLPNTDGWEVLEQLRRDGNQRVMMLTAR
GRLADKIKGLDMGADDYLVKPFEFPELLARVRTLLRRSEHIPVPDVLRVSDLELDPRRHRAYRGDRRIDLTTKEFALLHV
LMRQAGEVMTRTQIISLVWDMNFDCDTNVVEVSISRLRGKVDDQSEVKLIHTIRGVGYVLEARP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-55 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-54 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_002870368.1 two-component system response regulator BAC0083 Protein 1e-60 57
czcR YP_002870368.1 two-component system response regulator BAC0197 Protein 8e-62 57
czcR YP_002870368.1 two-component system response regulator BAC0638 Protein 2e-55 57
czcR YP_002870368.1 two-component system response regulator BAC0125 Protein 9e-61 56
czcR YP_002870368.1 two-component system response regulator BAC0308 Protein 2e-57 54
czcR YP_002870368.1 two-component system response regulator BAC0111 Protein 3e-60 52
czcR YP_002870368.1 two-component system response regulator BAC0347 Protein 2e-55 50
czcR YP_002870368.1 two-component system response regulator NC_002951.3238224.p0 Protein 4e-37 43
czcR YP_002870368.1 two-component system response regulator NC_007793.3914065.p0 Protein 4e-37 43
czcR YP_002870368.1 two-component system response regulator NC_002758.1121390.p0 Protein 4e-37 43
czcR YP_002870368.1 two-component system response regulator NC_010079.5776364.p0 Protein 4e-37 43
czcR YP_002870368.1 two-component system response regulator NC_002952.2859858.p0 Protein 4e-37 43
czcR YP_002870368.1 two-component system response regulator NC_007622.3794948.p0 Protein 4e-37 43
czcR YP_002870368.1 two-component system response regulator NC_003923.1003417.p0 Protein 4e-37 43
czcR YP_002870368.1 two-component system response regulator NC_013450.8614146.p0 Protein 4e-37 43
czcR YP_002870368.1 two-component system response regulator AE015929.1.gene1106. Protein 2e-33 43
czcR YP_002870368.1 two-component system response regulator U82965.2.orf14.gene. Protein 1e-33 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_002870368.1 two-component system response regulator VFG0596 Protein 2e-55 54
czcR YP_002870368.1 two-component system response regulator VFG1390 Protein 1e-42 45
czcR YP_002870368.1 two-component system response regulator VFG1386 Protein 2e-36 43
czcR YP_002870368.1 two-component system response regulator VFG1389 Protein 7e-37 43