Gene Information

Name : PFLU5290 (PFLU5290)
Accession : YP_002874790.1
Strain : Pseudomonas fluorescens SBW25
Genome accession: NC_012660
Putative virulence/resistance : Unknown
Product : transposase for insertion sequence element
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 5808597 - 5808905 bp
Length : 309 bp
Strand : -
Note : identical to PFLU2400 and PFLU5851

DNA sequence :
ATGCAAGAGCGAAAGACCTACACCCGCGAGTTCAAGCAACGTGCTGCAAGTATGGTTCTTGATGATAACTGCTCAGTTCC
TGACGTCTGTGCATCGATGGACGTTGGTCCTACGGCTCTGCGCCGCTGGGTTGATCAGGTTCGTAAAGAGCGTCAGAAAG
GGCAGCCAGTGGCAGGTACCAAGGCAATCAGCGACGAACAGCGAGAGCTTCAACAGCTGCGAGCCAAGGTCAAGCGCCTG
GAGACCGAGGCTGAAATCTTAAAAAAGGCTACGGCTCTCTTGATGTCGGATCCCGATCGTTTTTCCTGA

Protein sequence :
MQERKTYTREFKQRAASMVLDDNCSVPDVCASMDVGPTALRRWVDQVRKERQKGQPVAGTKAISDEQRELQQLRAKVKRL
ETEAEILKKATALLMSDPDRFS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 4e-17 52
l7045 CAD33744.1 - Not tested PAI I 536 Protein 3e-17 48
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 3e-17 48
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 5e-16 48
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-16 48
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-16 48
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-16 48
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-16 48
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-16 48
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-16 48
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-16 48
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-16 48
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-16 45
api80 CAF28554.1 putative transposase Not tested YAPI Protein 4e-14 44
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 5e-14 42
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 7e-14 42
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 1e-12 41
unnamed AAC31483.1 L0004 Not tested LEE Protein 1e-12 41
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-12 41
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PFLU5290 YP_002874790.1 transposase for insertion sequence element VFG1485 Protein 1e-17 48
PFLU5290 YP_002874790.1 transposase for insertion sequence element VFG1553 Protein 2e-16 48
PFLU5290 YP_002874790.1 transposase for insertion sequence element VFG1123 Protein 1e-16 48
PFLU5290 YP_002874790.1 transposase for insertion sequence element VFG0784 Protein 5e-13 41