Gene Information

Name : PFLU2572 (PFLU2572)
Accession : YP_002872159.1
Strain : Pseudomonas fluorescens SBW25
Genome accession: NC_012660
Putative virulence/resistance : Virulence
Product : putative two-component response regulator transcriptional regulatory protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2838007 - 2838690 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
ATGACCCGTATTTTGACCATCGAGGATGACGCCGTAACAGCCCGCGAGATCGTCGCCGAGCTGAGTAGCCATGGACTGGA
TGTAGACTGGGTAGACAACGGCCGCGAAGGCCTGGTCCGCGCAGTGAGTGGGGATTACGACCTGATCACCCTTGATCGCA
TGCTGCCGGAACTCGATGGCCTGGCCATCGTCACGACCCTGCGTACCATTGGTGTATCAACACCGATCCTGATGATCAGT
GCCCTCTCCGATGTCGACGAGCGCGTGCGCGGCCTGCGGGCCGGGGGTGATGATTACCTCACCAAGCCGTTCGCCTCGGA
TGAAATGGCCGCCCGTGTCGAAGTGCTGCTGCGACGCAAAAGCACGGTCAAGGAATTCGAAACCGCCCTGCGCGTGGCCG
ACCTGGAACTGAACCTGATCAGCCGCGAAGCCAGCCGCGCCGACCAGCCCCTGAGCCTGTTGCCCACCGAATACAAACTG
CTCGAGTTCCTGATGCGCAACACCGGACAGATCCTGTCGCGGATGATGATTTTCGAGGAAGTCTGGGGCTATCACTTCGA
CCCAGGTACCAACCTCATCGACGTGCACATCGGTCGCCTGCGCAAAAAGATCGACCCACCGGGCCTCACGCCGCTGATCC
GCACGGTACGAGGTTCCGGTTATGTCATTGCTGAACCCCTCTAA

Protein sequence :
MTRILTIEDDAVTAREIVAELSSHGLDVDWVDNGREGLVRAVSGDYDLITLDRMLPELDGLAIVTTLRTIGVSTPILMIS
ALSDVDERVRGLRAGGDDYLTKPFASDEMAARVEVLLRRKSTVKEFETALRVADLELNLISREASRADQPLSLLPTEYKL
LEFLMRNTGQILSRMMIFEEVWGYHFDPGTNLIDVHIGRLRKKIDPPGLTPLIRTVRGSGYVIAEPL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-33 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PFLU2572 YP_002872159.1 putative two-component response regulator transcriptional regulatory protein BAC0125 Protein 1e-38 46
PFLU2572 YP_002872159.1 putative two-component response regulator transcriptional regulatory protein BAC0197 Protein 3e-39 46
PFLU2572 YP_002872159.1 putative two-component response regulator transcriptional regulatory protein BAC0347 Protein 3e-40 45
PFLU2572 YP_002872159.1 putative two-component response regulator transcriptional regulatory protein BAC0111 Protein 6e-43 45
PFLU2572 YP_002872159.1 putative two-component response regulator transcriptional regulatory protein BAC0308 Protein 5e-40 44
PFLU2572 YP_002872159.1 putative two-component response regulator transcriptional regulatory protein BAC0083 Protein 6e-41 42
PFLU2572 YP_002872159.1 putative two-component response regulator transcriptional regulatory protein NC_012469.1.7686381. Protein 3e-37 41
PFLU2572 YP_002872159.1 putative two-component response regulator transcriptional regulatory protein BAC0638 Protein 4e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PFLU2572 YP_002872159.1 putative two-component response regulator transcriptional regulatory protein VFG1390 Protein 6e-38 43
PFLU2572 YP_002872159.1 putative two-component response regulator transcriptional regulatory protein VFG0596 Protein 3e-33 43
PFLU2572 YP_002872159.1 putative two-component response regulator transcriptional regulatory protein VFG1389 Protein 1e-31 42