Gene Information

Name : mprA (cauri_0825)
Accession : YP_002834360.1
Strain : Corynebacterium aurimucosum ATCC 700975
Genome accession: NC_012590
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 902801 - 903499 bp
Length : 699 bp
Strand : +
Note : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAAATTCTTGTCGTCGATGACGAGCAGGCTGTACGCGAATCGCTCCGCCGCTCTCTGAAGTTTAATGGCTACGAGGT
CATATTGGCCGCTGATGGCGTACAGGCTGTCGAGATGGTGCACAGTGAGCACCCAGAGCTTCTCATCCTCGATGTGATGA
TGCCGAACATGGACGGTCTGGAGGTCTGCCGCACCCTGCGCAGCGAAGGTTGGGACCGCCCCATTCTGGTATTGACGGCT
CGCGACGGAGTGTCTGACCGCGTTGCGGGTCTTGACGCCGGCGCCGATGACTATCTGCCCAAGCCCTTCGCTCTGGAAGA
GTTGCTAGCCCGCGTGCGTTCCTTGGTCCGCCGCGCCGCTGCGGAGTCGATAGCTAAGAAGCAGCCGGTCGAAACTCAGT
TGAGCTTTGAGGACCTCAAGCTCGATGCCGATACGCGTGAGGTGACCCGCGGCGAGCGTCAGATTTCTCTGACCCGCACT
GAGTTTGCCCTGCTGCGCCTGCTCATGGAGAACCCCCGCAAGGTGCTCTCCCGCAATACCATCCTGGAAGAGGTATGGGG
CTATGATTTCCCGACCTCCGGAAACGCTCTTGAGGTCTACATCGGTTATCTCCGTAAGAAGACTGAAGAAAGTGGCGAGC
CGCGTCTTATCCACACCGTGCGTGGCGTTGGCTACGTCATGAGGGAGGCTATCGCGTGA

Protein sequence :
MKILVVDDEQAVRESLRRSLKFNGYEVILAADGVQAVEMVHSEHPELLILDVMMPNMDGLEVCRTLRSEGWDRPILVLTA
RDGVSDRVAGLDAGADDYLPKPFALEELLARVRSLVRRAAAESIAKKQPVETQLSFEDLKLDADTREVTRGERQISLTRT
EFALLRLLMENPRKVLSRNTILEEVWGYDFPTSGNALEVYIGYLRKKTEESGEPRLIHTVRGVGYVMREAIA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-35 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-35 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_002834360.1 two-component system response regulator BAC0083 Protein 3e-34 49
mprA YP_002834360.1 two-component system response regulator BAC0125 Protein 2e-33 45
mprA YP_002834360.1 two-component system response regulator HE999704.1.gene1528. Protein 9e-38 45
mprA YP_002834360.1 two-component system response regulator BAC0111 Protein 3e-33 44
mprA YP_002834360.1 two-component system response regulator BAC0638 Protein 6e-26 44
mprA YP_002834360.1 two-component system response regulator BAC0197 Protein 1e-30 43
mprA YP_002834360.1 two-component system response regulator AE000516.2.gene3505. Protein 2e-35 43
mprA YP_002834360.1 two-component system response regulator NC_007622.3794948.p0 Protein 9e-35 41
mprA YP_002834360.1 two-component system response regulator NC_003923.1003417.p0 Protein 9e-35 41
mprA YP_002834360.1 two-component system response regulator NC_013450.8614146.p0 Protein 9e-35 41
mprA YP_002834360.1 two-component system response regulator NC_002951.3238224.p0 Protein 9e-35 41
mprA YP_002834360.1 two-component system response regulator NC_007793.3914065.p0 Protein 9e-35 41
mprA YP_002834360.1 two-component system response regulator NC_002758.1121390.p0 Protein 9e-35 41
mprA YP_002834360.1 two-component system response regulator AE015929.1.gene1106. Protein 2e-30 41
mprA YP_002834360.1 two-component system response regulator NC_010079.5776364.p0 Protein 9e-35 41
mprA YP_002834360.1 two-component system response regulator NC_002952.2859858.p0 Protein 9e-35 41
mprA YP_002834360.1 two-component system response regulator BAC0308 Protein 2e-30 41
mprA YP_002834360.1 two-component system response regulator AF155139.2.orf0.gene Protein 5e-31 41
mprA YP_002834360.1 two-component system response regulator CP000034.1.gene3671. Protein 7e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_002834360.1 two-component system response regulator VFG1390 Protein 6e-70 71
mprA YP_002834360.1 two-component system response regulator VFG1386 Protein 2e-46 50
mprA YP_002834360.1 two-component system response regulator VFG1389 Protein 3e-39 46
mprA YP_002834360.1 two-component system response regulator VFG0596 Protein 2e-35 43