Gene Information

Name : NGR_c07840 (NGR_c07840)
Accession : YP_002825330.1
Strain : Sinorhizobium fredii NGR234
Genome accession: NC_012587
Putative virulence/resistance : Virulence
Product : two-component response regulator transcriptional regulatory protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 838036 - 838737 bp
Length : 702 bp
Strand : +
Note : -

DNA sequence : 
ATGGTCACCCGTATGAAGATTCTGATTGTTGAAGATGATCTCGAGGCGGCCGCCTATCTTGCGAAGGCGTTCCGCGAAGC
GGGCATCGTGTCCGACCACGCCAGCGACGGCGAGAGCGGCTTGTTCATGGCGAGCGAAAACGCCTATGACGCGCTCGTCG
TGGACCGCATGTTGCCGCGCCGGGACGGTCTGTCGCTGATCAGCGAATTGAGGCGCAGGGGCATCCATACGCCGGTGCTC
ATCCTCTCGGCCCTCGGCCAGGTGGACGACCGGGTGACCGGCCTTCGCGCCGGCGGCGACGACTACCTCCCCAAACCCTA
TGCTTTCAGCGAGCTCCTGGCGCGCGTCGAAGTGCTCGGCCGGCGCAAGGGCACGCCCGACCAGGACATGGTCTATCGCG
TCGGCGACCTCGAACTGGACCGGCTCGCCCATTCGGTCCGCCGACAGGGCAAGGAAATCCCGCTGCAGCCCCGCGAGTTC
CGGCTGCTCGAATATCTGATGAAGAATGCCGGGCAGGTCGTGACCAGAACCATGCTGCTCGAAAACGTGTGGGATTATCA
TTTCGACCCGCAGACCAACGTGATCGACGTGCATGTGTCGCGCTTGCGCTCCAAGATCGAGAAGGATTTCGAACCGCCGC
TGCTGAGGACCGTTCGCGGCGCCGGCTACATGATCAAGGACGACCGGATCGCCGAGGCATGA

Protein sequence : 
MVTRMKILIVEDDLEAAAYLAKAFREAGIVSDHASDGESGLFMASENAYDALVVDRMLPRRDGLSLISELRRRGIHTPVL
ILSALGQVDDRVTGLRAGGDDYLPKPYAFSELLARVEVLGRRKGTPDQDMVYRVGDLELDRLAHSVRRQGKEIPLQPREF
RLLEYLMKNAGQVVTRTMLLENVWDYHFDPQTNVIDVHVSRLRSKIEKDFEPPLLRTVRGAGYMIKDDRIAEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NGR_c07840 YP_002825330.1 two-component response regulator transcriptional regulatory protein BAC0347 Protein 2e-45 47
NGR_c07840 YP_002825330.1 two-component response regulator transcriptional regulatory protein BAC0083 Protein 8e-45 46
NGR_c07840 YP_002825330.1 two-component response regulator transcriptional regulatory protein BAC0111 Protein 7e-49 46
NGR_c07840 YP_002825330.1 two-component response regulator transcriptional regulatory protein BAC0308 Protein 2e-42 46
NGR_c07840 YP_002825330.1 two-component response regulator transcriptional regulatory protein BAC0197 Protein 3e-43 45
NGR_c07840 YP_002825330.1 two-component response regulator transcriptional regulatory protein BAC0638 Protein 4e-37 45
NGR_c07840 YP_002825330.1 two-component response regulator transcriptional regulatory protein BAC0125 Protein 1e-45 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NGR_c07840 YP_002825330.1 two-component response regulator transcriptional regulatory protein VFG1390 Protein 2e-38 44
NGR_c07840 YP_002825330.1 two-component response regulator transcriptional regulatory protein VFG1389 Protein 4e-34 43
NGR_c07840 YP_002825330.1 two-component response regulator transcriptional regulatory protein VFG0596 Protein 2e-38 41