Gene Information

Name : NGR_c07760 (NGR_c07760)
Accession : YP_002825322.1
Strain : Sinorhizobium fredii NGR234
Genome accession: NC_012587
Putative virulence/resistance : Virulence
Product : two-component response regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 829086 - 829757 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGCGCATCCTGATAATCGAGGACGACGTCAATCTGAACAGGCAACTGGCCGAAGCGTTGAAGGAAGCCGGTTACGTCGT
CGACCAGGCCTATGACGGCGAGGAGGGCCACTATCTCGGCGACGCGGAACCCTACGACGCGATCATCCTCGATATCGGCC
TGCCGGAAATGGACGGCATCACCGCGCTGGAAAGGTGGCGCGCCGACGGCAAGACCATGCCGGTGCTGATCCTGACGGCC
CGCGACCGCTGGAGCGACAAGGTGGCGGGCATCGATGCCGGCGCCGACGACTATGTCGCGAAGCCCTTCCATGTTCAGGA
GGTGCTCGCCCGCATCCGGGCGCTGATCCGTCGCGCCGCGGGGCATGCCAGTTCCGAGATCGTCTGCGGCCCCGTGCGCC
TCGACACGAAAGGCTCGAAGGCGACCGTCGGCGGTGTTGCGCTGAAGCTGACCTCCCACGAGTTCCGGCTGCTCTCCTAT
CTCATGCACCACATGGGCCAGGTTGTTTCCCGCACGGAGCTTGTCGAGCACATGTATGATCAGGACTTCGACCGCGACTC
CAACACGATCGAGGTCTTCATCGGCCGACTCCGCAAGAAGATCGGCAATGACCTGATCGAAACCGTGCGCGGTCTCGGAT
ATCGGATGCAAGCACCCGGCAATGGTCATTAG

Protein sequence :
MRILIIEDDVNLNRQLAEALKEAGYVVDQAYDGEEGHYLGDAEPYDAIILDIGLPEMDGITALERWRADGKTMPVLILTA
RDRWSDKVAGIDAGADDYVAKPFHVQEVLARIRALIRRAAGHASSEIVCGPVRLDTKGSKATVGGVALKLTSHEFRLLSY
LMHHMGQVVSRTELVEHMYDQDFDRDSNTIEVFIGRLRKKIGNDLIETVRGLGYRMQAPGNGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-27 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NGR_c07760 YP_002825322.1 two-component response regulator protein NC_002516.2.879194.p Protein 2e-37 46
NGR_c07760 YP_002825322.1 two-component response regulator protein CP000647.1.gene1136. Protein 3e-36 45
NGR_c07760 YP_002825322.1 two-component response regulator protein CP004022.1.gene1005. Protein 5e-40 45
NGR_c07760 YP_002825322.1 two-component response regulator protein BAC0487 Protein 2e-27 45
NGR_c07760 YP_002825322.1 two-component response regulator protein BAC0530 Protein 3e-36 45
NGR_c07760 YP_002825322.1 two-component response regulator protein CP001918.1.gene2526. Protein 1e-35 44
NGR_c07760 YP_002825322.1 two-component response regulator protein CP001138.1.gene1939. Protein 3e-36 44
NGR_c07760 YP_002825322.1 two-component response regulator protein NC_002695.1.913289.p Protein 1e-35 43
NGR_c07760 YP_002825322.1 two-component response regulator protein CP000034.1.gene2022. Protein 3e-36 43
NGR_c07760 YP_002825322.1 two-component response regulator protein BAC0111 Protein 8e-31 42
NGR_c07760 YP_002825322.1 two-component response regulator protein BAC0197 Protein 1e-29 42
NGR_c07760 YP_002825322.1 two-component response regulator protein BAC0347 Protein 1e-27 41
NGR_c07760 YP_002825322.1 two-component response regulator protein BAC0083 Protein 1e-29 41
NGR_c07760 YP_002825322.1 two-component response regulator protein BAC0125 Protein 2e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NGR_c07760 YP_002825322.1 two-component response regulator protein VFG0475 Protein 3e-36 44
NGR_c07760 YP_002825322.1 two-component response regulator protein VFG0596 Protein 2e-27 42
NGR_c07760 YP_002825322.1 two-component response regulator protein VFG0473 Protein 4e-28 42
NGR_c07760 YP_002825322.1 two-component response regulator protein VFG1389 Protein 9e-28 41