Gene Information

Name : NGR_b09770 (NGR_b09770)
Accession : YP_002823183.1
Strain :
Genome accession: NC_012586
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 959856 - 960203 bp
Length : 348 bp
Strand : +
Note : -

DNA sequence :
ATGATCCCGATCAGTTCCGGGGTGCGGGTGTGGATCGCGAGCGGTCACTGCGACATGCGCAAGGGCATGCAGGGTCTGGC
GCTGCTGGTGCAGGAAGGCCTCGGTCGCGATCCGTTTAGGGGCGACGTCTTCGTCTTTCGGGGGCGCAGCGGCCGACTGA
TAAAAGCTCTTTGGCATGATGGGATCGGCCTATCGCTATATGCGAAACGGCTCGAGCGCGGCCGCTTCATCTGGCCGGCG
ACGGAGGGTGGCGCGATCGCGCTGACCGCCGGTCAGATGTCCTATCTGCTGGAAGGGATCGATTGGCGAAACCCGCAGCA
GAGCTGGCGTCCGACCAGCGCGGGGTGA

Protein sequence :
MIPISSGVRVWIASGHCDMRKGMQGLALLVQEGLGRDPFRGDVFVFRGRSGRLIKALWHDGIGLSLYAKRLERGRFIWPA
TEGGAIALTAGQMSYLLEGIDWRNPQQSWRPTSAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 6e-25 56
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-27 55
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-27 55
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-25 55
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-25 55
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-25 55
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-25 55
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-25 55
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-25 55
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-25 55
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-25 55
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-19 54
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-25 54
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-25 54
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 7e-25 54
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 7e-25 54
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 3e-27 53
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 3e-27 53
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-25 53
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 6e-27 52
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-25 49
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 5e-25 49
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 5e-25 49
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 5e-24 47
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 5e-24 47

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NGR_b09770 YP_002823183.1 transposase VFG1709 Protein 4e-26 55
NGR_b09770 YP_002823183.1 transposase VFG0792 Protein 4e-26 55
NGR_b09770 YP_002823183.1 transposase VFG1517 Protein 8e-20 54
NGR_b09770 YP_002823183.1 transposase VFG1698 Protein 4e-26 54
NGR_b09770 YP_002823183.1 transposase VFG1052 Protein 9e-26 53
NGR_b09770 YP_002823183.1 transposase VFG1665 Protein 3e-27 52
NGR_b09770 YP_002823183.1 transposase VFG1737 Protein 2e-25 49