Gene Information

Name : BAMEG_0340 (BAMEG_0340)
Accession : YP_002812961.1
Strain : Bacillus anthracis CDC 684
Genome accession: NC_012581
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 289220 - 289933 bp
Length : 714 bp
Strand : -
Note : identified by match to protein family HMM PF00072; match to protein family HMM PF00486

DNA sequence :
ATGAAAGATATACGTATCCTTATAGCAGATGATGATAAAGAAATCCGTAATTTACTAAAAATATATTTAGAACGAGAATT
ATATATGGTAGATACTGCGATTGATGGCGAAGTAGCCTTACAGTTATTTAATCAAAACAACTATAGCATCGTTATATTAG
ATCTTATGATGCCAAAAGTAGATGGTATCGAAGTATGTAGAAAGCTTAGAGATAAAACTAACGTACCGATATTAATGCTA
ACCGCTAAAGATCACGAAGTCGATAAAATTTTAGGTTTAAGCATTGGTGCTGATGATTACATTACGAAGCCTTTCAGCAT
TCACGAAGTAGTTGCACGAGTCAAAGCTCTTATACGGCGTTTTTTAGTTCTTGGAAGTAACATTAATGTACAAGAGAAGA
CAACTTTAGCTTTTAAAGGACTAACTATCAATTTAAATACATATACAGTTCACACAAATAAAGAAGAAATCAGCTTAACC
GGAAAAGAACTAGAACTATTAAAATTCTTTACTTCAAACCCAGGACAAGTATTTACAAAAACACAGCTCTTTCGCAATGT
ATGGGACGATAATTATATAGAAGATGATAATACCGTTATGGTACATATTCGAAAACTTAGAAAGAAAATAGAAATCGATC
CTTCCAATCCAAAATTCATTCAAACTGTATGGGGAATTGGCTATAAGTTTGTAGGTGAAAAGCTTGAAGATTGA

Protein sequence :
MKDIRILIADDDKEIRNLLKIYLERELYMVDTAIDGEVALQLFNQNNYSIVILDLMMPKVDGIEVCRKLRDKTNVPILML
TAKDHEVDKILGLSIGADDYITKPFSIHEVVARVKALIRRFLVLGSNINVQEKTTLAFKGLTINLNTYTVHTNKEEISLT
GKELELLKFFTSNPGQVFTKTQLFRNVWDDNYIEDDNTVMVHIRKLRKKIEIDPSNPKFIQTVWGIGYKFVGEKLED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-43 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-42 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BAMEG_0340 YP_002812961.1 DNA-binding response regulator AF155139.2.orf0.gene Protein 2e-51 50
BAMEG_0340 YP_002812961.1 DNA-binding response regulator FJ349556.1.orf0.gene Protein 5e-48 47
BAMEG_0340 YP_002812961.1 DNA-binding response regulator HE999704.1.gene2815. Protein 3e-44 46
BAMEG_0340 YP_002812961.1 DNA-binding response regulator NC_014475.1.orf0.gen Protein 3e-44 45
BAMEG_0340 YP_002812961.1 DNA-binding response regulator NC_005054.2598277.p0 Protein 3e-44 45
BAMEG_0340 YP_002812961.1 DNA-binding response regulator NC_012469.1.7685629. Protein 3e-43 45
BAMEG_0340 YP_002812961.1 DNA-binding response regulator AM180355.1.gene1830. Protein 1e-45 45
BAMEG_0340 YP_002812961.1 DNA-binding response regulator NC_003923.1003749.p0 Protein 5e-42 44
BAMEG_0340 YP_002812961.1 DNA-binding response regulator EU250284.1.orf4.gene Protein 4e-42 43
BAMEG_0340 YP_002812961.1 DNA-binding response regulator NC_002952.2859905.p0 Protein 5e-42 43
BAMEG_0340 YP_002812961.1 DNA-binding response regulator NC_009782.5559369.p0 Protein 7e-42 43
BAMEG_0340 YP_002812961.1 DNA-binding response regulator NC_002951.3237708.p0 Protein 7e-42 43
BAMEG_0340 YP_002812961.1 DNA-binding response regulator NC_007622.3794472.p0 Protein 5e-42 43
BAMEG_0340 YP_002812961.1 DNA-binding response regulator DQ212986.1.gene4.p01 Protein 1e-44 43
BAMEG_0340 YP_002812961.1 DNA-binding response regulator NC_002758.1121668.p0 Protein 7e-42 43
BAMEG_0340 YP_002812961.1 DNA-binding response regulator NC_009641.5332272.p0 Protein 7e-42 43
BAMEG_0340 YP_002812961.1 DNA-binding response regulator NC_013450.8614421.p0 Protein 7e-42 43
BAMEG_0340 YP_002812961.1 DNA-binding response regulator NC_007793.3914279.p0 Protein 7e-42 43
BAMEG_0340 YP_002812961.1 DNA-binding response regulator NC_002745.1124361.p0 Protein 7e-42 43
BAMEG_0340 YP_002812961.1 DNA-binding response regulator AE016830.1.gene1681. Protein 1e-42 42
BAMEG_0340 YP_002812961.1 DNA-binding response regulator AF130997.1.orf0.gene Protein 7e-41 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BAMEG_0340 YP_002812961.1 DNA-binding response regulator VFG1563 Protein 1e-43 42
BAMEG_0340 YP_002812961.1 DNA-binding response regulator VFG1702 Protein 7e-43 42