|
Name : BAMEG_A0127 (BAMEG_A0127) Accession : YP_002811563.1 Strain : Genome accession: NC_012579 Putative virulence/resistance : Unknown Product : integrase, catalytic region Function : - COG functional category : L : Replication, recombination and repair COG ID : COG2801 EC number : - Position : 117287 - 117502 bp Length : 216 bp Strand : + Note : an automated process has identified a potential problem with this gene model; the current end5 and/or the end3 may need to extended or the current gene model may need to be merged with a neighboring gene model; the current gene model (or a revised gene mo DNA sequence : ATGTCCCGTAAAGGAAATTGTCATGATAATGCCGTAATAGAATCTTTTCATTCCTCATTGAAATCTGAATTGTTTTATTC CCAAGAAAAACAAATACATTCAACTTCTACTCTCAAACAACTCATTCACGATTACATTGAGTATTATAATACGGAACGTA TTCAAGAAAAGTTAAACTACCTGTCTCCTATAGAATACAAGAAACAGGTAGCATAG Protein sequence : MSRKGNCHDNAVIESFHSSLKSELFYSQEKQIHSTSTLKQLIHDYIEYYNTERIQEKLNYLSPIEYKKQVA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| M5005_Spy_0166 | YP_281530.1 | transposase | Not tested | Not named | Protein | 6e-07 | 44 |
| EXB3 | ABD94690.1 | transposase derived protein | Not tested | ExoU island B | Protein | 0.013 | 41 |
