Gene Information

Name : rpmJ (VCM66_0836)
Accession : YP_002809606.1
Strain :
Genome accession: NC_012578
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L36
Function : -
COG functional category : J : Translation, ribosomal structure and biogenesis
COG ID : COG0257
EC number : -
Position : 898331 - 898456 bp
Length : 126 bp
Strand : +
Note : smallest protein in the large subunit; similar to what is found with protein L31 and L33 several bacterial genomes contain paralogs which may be regulated by zinc; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound zinc io

DNA sequence :
ATGAAAGTGCTCAGCTCGCTAAAAAGCGCTAAAAATCGTCACCCAGATTGTCAAATCGTCAAACGCCGTGGCCGTTTGTA
TGTGATCTGCAAATCAAATCCTCGCTTTAAAGCCGTTCAGCGCTAG

Protein sequence :
MKVLSSLKSAKNRHPDCQIVKRRGRLYVICKSNPRFKAVQR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
rpmJ YP_001800879.1 50S ribosomal protein L36 Not tested Not named Protein 1e-04 58