Gene Information

Name : mprA (ROP_56850)
Accession : YP_002782877.1
Strain : Rhodococcus opacus B4
Genome accession: NC_012522
Putative virulence/resistance : Virulence
Product : two-component response regulator MprA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 6215159 - 6215845 bp
Length : 687 bp
Strand : +
Note : -

DNA sequence :
ATGCGCATTTTGGTGGTCGACGACGATCGCGCCGTGAGGGAGTCCCTACGGCGGTCTCTCAGCTTCAACGGGTACTCGGT
GGAACTGGCCGTCGACGGTATCGATGCTCTCGAGAAGGTCGCGAACGCGCGCCCCGACGCGCTCGTGCTCGATGTGATGA
TGCCGCGCCTGGACGGTCTCGAGGTGTGCCGCCGGTTGCGGAGCACCGGCGACGACCTGCCGATTCTCGTCCTGACGGCG
CGCGACTCCGTGTCGGAGCGGGTGTCGGGCCTGGACGCCGGAGCCGACGACTACCTGCCGAAGCCGTTCGCCCTCGAGGA
GTTGCTGGCCAGGTTACGTGCGCTGCTGCGCCGCGCGGCTCCGGAGCCGGGCATCGATTCGGAGAAGATGACGTTCGAGG
ACCTCACGCTCGACCCGGTCACCCGTGAGGTGACGCGCGGCGAGCGGTCCATCAGCCTCACCCGCACCGAGTTCTCGCTC
CTCGAGATGCTGATGGCCAATCCTCGCCGGGTGCTCACCCGCGGGCGCATTCTCGAGGAGGTGTGGGGTTACGACTTCCC
GACGTCCGGCAACGCGCTCGAGGTCTACGTCGGGTATCTGCGTCGCAAGACGGAGGCGGACGGAGAGACCCGCCTGCTGC
ACACCGTGCGCGGGGTCGGCTACGTGCTGCGGGAGACTCCTCCGTGA

Protein sequence :
MRILVVDDDRAVRESLRRSLSFNGYSVELAVDGIDALEKVANARPDALVLDVMMPRLDGLEVCRRLRSTGDDLPILVLTA
RDSVSERVSGLDAGADDYLPKPFALEELLARLRALLRRAAPEPGIDSEKMTFEDLTLDPVTREVTRGERSISLTRTEFSL
LEMLMANPRRVLTRGRILEEVWGYDFPTSGNALEVYVGYLRRKTEADGETRLLHTVRGVGYVLRETPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-31 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_002782877.1 two-component response regulator MprA HE999704.1.gene1528. Protein 2e-37 46
mprA YP_002782877.1 two-component response regulator MprA AE000516.2.gene3505. Protein 3e-33 45
mprA YP_002782877.1 two-component response regulator MprA BAC0125 Protein 1e-33 44
mprA YP_002782877.1 two-component response regulator MprA BAC0638 Protein 9e-29 44
mprA YP_002782877.1 two-component response regulator MprA BAC0308 Protein 3e-32 43
mprA YP_002782877.1 two-component response regulator MprA BAC0083 Protein 4e-35 42
mprA YP_002782877.1 two-component response regulator MprA NC_012469.1.7686381. Protein 3e-32 41
mprA YP_002782877.1 two-component response regulator MprA U82965.2.orf14.gene. Protein 4e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_002782877.1 two-component response regulator MprA VFG1390 Protein 2e-83 87
mprA YP_002782877.1 two-component response regulator MprA VFG1389 Protein 3e-43 51
mprA YP_002782877.1 two-component response regulator MprA VFG1386 Protein 1e-44 47
mprA YP_002782877.1 two-component response regulator MprA VFG0596 Protein 5e-32 41