Name : rpmE2 (ROP_56830) Accession : YP_002782875.1 Strain : Rhodococcus opacus B4 Genome accession: NC_012522 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L31 type B Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0254 EC number : - Position : 6214160 - 6214414 bp Length : 255 bp Strand : + Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g DNA sequence : ATGAAACCAGGAATCCATCCCGACTACCACCCCGTGGTGTTCCAGGACGCGAGCACCGGAACCACGTTCCTCACACGGTC GACGCTCACCAGCGACCGCACTGCCGTGTGGGAGGACGGCAACACCTATCCGCTGGTGGTCGTGGACGTGACCAGCGAGT CGCACCCGTTCTGGACCGGCGCGCAGCGCGTGATGGACACCGCGGGCCGCGTCGAGAAGTTCGAACGCCGCTATGGAGTG CGCAAGCGCCCGTGA Protein sequence : MKPGIHPDYHPVVFQDASTGTTFLTRSTLTSDRTAVWEDGNTYPLVVVDVTSESHPFWTGAQRVMDTAGRVEKFERRYGV RKRP |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
rpmE2 | NP_286687.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 1e-09 | 49 |
rpmE2 | NP_287095.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 1e-09 | 49 |