Gene Information

Name : ROP_21750 (ROP_21750)
Accession : YP_002779367.1
Strain : Rhodococcus opacus B4
Genome accession: NC_012522
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2332835 - 2333410 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
ATGGGCGTCAGCTTGACCAAGGGCGGCATTGTTTCTCTCACGAAGGAGGCGCCGAACCTGACCGCGGTGGCTGTCGGACT
CGGATGGGATGCCCGCTCGACCACCGGCACCGACTTCGACCTCGACGCCAGCGCCATCGGTGCGGGTGCCGACAAGAAGG
TCGTGTCGGACCAGCACTTCGTGTTCTTCAACAACCTGCGTTCCCCCGACGGCTCGATCGAGCACATCGGCGACAACACC
ACCGGTGCGGGCGAGGGCGACGACGAGGTGATCAACGTCAACCTGGCGGCGGTCCCCGCGAACATCGAGAGCATCCTGTT
CCCCGTCTCGATCTACGATGCGGAGACGCGTTCGCAGTCGTTCGGTCAGGTGCGCAACGCCTACATCCGCGTCGTCGACC
AGGCCAACGGCAACGAGCTCGCCCGCTACGACCTGTCCGAGGATGCGTCGACCGAGACCGCTATGGTCTTCGGCGAGCTG
TACCGCAACGGTGCGGAGTGGAAGTTCCGCGCCATCGGCCAGGGCTACGCGTCCGGGCTGGCCGGTATCGCCCGCGACTA
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLTKGGIVSLTKEAPNLTAVAVGLGWDARSTTGTDFDLDASAIGAGADKKVVSDQHFVFFNNLRSPDGSIEHIGDNT
TGAGEGDDEVINVNLAAVPANIESILFPVSIYDAETRSQSFGQVRNAYIRVVDQANGNELARYDLSEDASTETAMVFGEL
YRNGAEWKFRAIGQGYASGLAGIARDYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-58 63
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-58 63
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-58 63
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-55 62
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-58 62
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-57 62
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-57 62
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-56 61
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-27 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-27 42
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-31 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ROP_21750 YP_002779367.1 tellurium resistance protein BAC0389 Protein 1e-56 61
ROP_21750 YP_002779367.1 tellurium resistance protein BAC0390 Protein 4e-57 59
ROP_21750 YP_002779367.1 tellurium resistance protein BAC0392 Protein 4e-27 43