Gene Information

Name : ROP_00140 (ROP_00140)
Accession : YP_002777206.1
Strain : Rhodococcus opacus B4
Genome accession: NC_012522
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 12666 - 13097 bp
Length : 432 bp
Strand : -
Note : -

DNA sequence :
GTGGGGTACGGGGTTGAGAATGGCGGCATGCGTAGCAGTGAGGTCGCCGCCCGCACCGGGGTGAATGTGCAGACGCTGCG
GTACTACGAGCGCCGCGGCCTGTTGACGCCGCCGCCGCGGTCGCCGGCCGGGTATCGGGCGTATCCGGCCGACGCCGTGG
CGGTGGTCCGATTCGTCAAACGGGCTCAGGGGCACGGGTTCAGCCTCGACGAGATCGAGGACCTGTTGCATCTGGCCGAG
GGCGGACCGGATGACTGCAATACGGCGCGGGAACTCGCCGAGGCCAAGCTCGCTCAGCTGGCCGAGAAGATCGCCGACCT
GCAACGCATGCAGCGGTCCCTCTCCGATCTCGTCGCCACGTGCGAGCGGCCACGCACCGACCGGTGCTGCCCGCTGCTGC
ACACCCTGCACACCGAAGGAGATGACCGATGA

Protein sequence :
MGYGVENGGMRSSEVAARTGVNVQTLRYYERRGLLTPPPRSPAGYRAYPADAVAVVRFVKRAQGHGFSLDEIEDLLHLAE
GGPDDCNTARELAEAKLAQLAEKIADLQRMQRSLSDLVATCERPRTDRCCPLLHTLHTEGDDR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 4e-19 48
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 5e-19 48
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 2e-16 46
merR AGK07025.1 MerR Not tested SGI1 Protein 3e-19 46
merR AGK07083.1 MerR Not tested SGI1 Protein 3e-19 46
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-19 46
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-19 46
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 4e-19 46
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-19 46
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 7e-18 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ROP_00140 YP_002777206.1 MerR family transcriptional regulator BAC0684 Protein 9e-20 49
ROP_00140 YP_002777206.1 MerR family transcriptional regulator BAC0688 Protein 1e-20 48
ROP_00140 YP_002777206.1 MerR family transcriptional regulator BAC0683 Protein 3e-19 48
ROP_00140 YP_002777206.1 MerR family transcriptional regulator BAC0687 Protein 1e-19 47
ROP_00140 YP_002777206.1 MerR family transcriptional regulator BAC0232 Protein 1e-19 47
ROP_00140 YP_002777206.1 MerR family transcriptional regulator BAC0689 Protein 2e-18 47
ROP_00140 YP_002777206.1 MerR family transcriptional regulator BAC0686 Protein 2e-20 46