Gene Information

Name : ROP_pROB01-01890 (ROP_pROB01-01890)
Accession : YP_002776540.1
Strain :
Genome accession: NC_012520
Putative virulence/resistance : Resistance
Product : putative OmpR family two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 180165 - 180839 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGCGAATCCTCTTGGTCGAGGACGAGGCCCGACTGGCCGAGACCGTGCGGCGTGGACTGACGGCCGAGGGCTTCGTCGT
CGATGTCGCGCGCGAGGGATGCGACGGGCTCGAACAGGCCGTGACCGGAGATTTCGACGTGGTCGTGCTCGACATCATGC
TGCCCGGCATGCACGGCTACCAGATCCTGCGGGAGCTGCGCGCACGCCAGGTGTGGACTCCGGTGCTCATGCTCTCGGCC
AAGGACGGCGAATACGACCAGGCGGACGCCTTCGACCTCGGCGCCGACGACTACCTGACCAAGCCGTTCTCGTTCGTGAT
CCTGGTGGCGCGGTTGCGCGCCCTGCTGCGGCGCGGGGCCCCCGAGCGGCCGGCGATCCTCACCGCGGGCAACCTGGCAC
TCGACCCGGCCCGCCGGCGCGTGAGCCGGGGGGAGGACGTACTCGCCCTGACACCCCGCGAGTACGGGGTGCTCGAATTC
TTGCTGCGGAACAAGGGGGACGTCGTCAGCAAGGCGGAGATCCTGCGCTCGGTGTGGGACAGCAACTACGACGGCGACGA
CAACGTCGTCGAGGTATACATCGGCTACCTGCGGCGAAAGATCGACGCACCGTTCGGCATGGCCACCATCGAAACGGTGC
GCGGCGTCGGCTACCGGCTACTCGACGCCCAATGA

Protein sequence :
MRILLVEDEARLAETVRRGLTAEGFVVDVAREGCDGLEQAVTGDFDVVVLDIMLPGMHGYQILRELRARQVWTPVLMLSA
KDGEYDQADAFDLGADDYLTKPFSFVILVARLRALLRRGAPERPAILTAGNLALDPARRRVSRGEDVLALTPREYGVLEF
LLRNKGDVVSKAEILRSVWDSNYDGDDNVVEVYIGYLRRKIDAPFGMATIETVRGVGYRLLDAQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 4e-29 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-28 41
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-36 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ROP_pROB01-01890 YP_002776540.1 putative OmpR family two-component response regulator BAC0125 Protein 7e-41 47
ROP_pROB01-01890 YP_002776540.1 putative OmpR family two-component response regulator BAC0197 Protein 5e-39 46
ROP_pROB01-01890 YP_002776540.1 putative OmpR family two-component response regulator Y16952.3.orf35.gene. Protein 3e-26 45
ROP_pROB01-01890 YP_002776540.1 putative OmpR family two-component response regulator BAC0308 Protein 6e-34 44
ROP_pROB01-01890 YP_002776540.1 putative OmpR family two-component response regulator U82965.2.orf14.gene. Protein 2e-25 43
ROP_pROB01-01890 YP_002776540.1 putative OmpR family two-component response regulator BAC0111 Protein 6e-37 42
ROP_pROB01-01890 YP_002776540.1 putative OmpR family two-component response regulator AF310956.2.orf0.gene Protein 2e-29 41
ROP_pROB01-01890 YP_002776540.1 putative OmpR family two-component response regulator AE016830.1.gene2255. Protein 1e-28 41
ROP_pROB01-01890 YP_002776540.1 putative OmpR family two-component response regulator U35369.1.gene1.p01 Protein 1e-28 41
ROP_pROB01-01890 YP_002776540.1 putative OmpR family two-component response regulator BAC0083 Protein 7e-36 41
ROP_pROB01-01890 YP_002776540.1 putative OmpR family two-component response regulator BAC0638 Protein 6e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ROP_pROB01-01890 YP_002776540.1 putative OmpR family two-component response regulator VFG0596 Protein 1e-36 41