Gene Information

Name : yycF (BBR47_59130)
Accession : YP_002775394.1
Strain : Brevibacillus brevis NBRC 100599
Genome accession: NC_012491
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 6262426 - 6263136 bp
Length : 711 bp
Strand : -
Note : -

DNA sequence :
ATGGCAAAACTCCTCGTAGTTGACGATGAAAAACCGATTGCAGATATTTTGAAATTCACGTTTGAAAAAGAAGGATATCA
GGTTGTATGTGCCTACGATGGTGATGAGGCACTTGTCGTGGTCAAGGATGAGCGACCGGATCTGATTTTATTAGATGTTA
TGCTTCCGGGCAGAGACGGAATGGACGTATGCCGAACCGTTCGCCAAACGTATGATGTTCCGATCATCATGCTGACTGCC
AAAGACTCTGAATTGGATAAAGTACTCGGGCTGGAATTGGGCGCGGACGATTATGTGACAAAGCCATTTAGTACGCGTGA
GCTGGTAGCCCGTGTAAAGGCACATTTACGCCGTAACCGCTCGAAAGTGGAAGAGAAGGATAGCCAGCATGTACTGCGCG
TGCATGAGCTGGAAATCGATTTGAACTCGTATACCGTCGAAAAGGTGGGAGAAGCATTAGAGCTGACGCACCGTGAGTTT
GAGCTGCTGGTGTACCTCGCTCGCCATCAAGGACAAGTATTGACGAGAGAGCATCTCCTGCAGTCGGTCTGGGGATTTGA
CTATTTTGGCGATGTGCGGACGGTAGATGTGACCATCCGTCGTTTGCGTGAAAAAATCGAGGATGATCCAAGTCAGCCGA
AGTACATTATCACGCGGCGTGGTTTGGGTTATACATTACGTAATCCCGGCATGGGAGGCCAGCCTGGATGA

Protein sequence :
MAKLLVVDDEKPIADILKFTFEKEGYQVVCAYDGDEALVVVKDERPDLILLDVMLPGRDGMDVCRTVRQTYDVPIIMLTA
KDSELDKVLGLELGADDYVTKPFSTRELVARVKAHLRRNRSKVEEKDSQHVLRVHELEIDLNSYTVEKVGEALELTHREF
ELLVYLARHQGQVLTREHLLQSVWGFDYFGDVRTVDVTIRRLREKIEDDPSQPKYIITRRGLGYTLRNPGMGGQPG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-38 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-38 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yycF YP_002775394.1 two-component response regulator NC_012469.1.7685629. Protein 9e-70 63
yycF YP_002775394.1 two-component response regulator NC_002952.2859905.p0 Protein 7e-58 57
yycF YP_002775394.1 two-component response regulator NC_013450.8614421.p0 Protein 9e-58 57
yycF YP_002775394.1 two-component response regulator NC_007793.3914279.p0 Protein 9e-58 57
yycF YP_002775394.1 two-component response regulator NC_002745.1124361.p0 Protein 9e-58 57
yycF YP_002775394.1 two-component response regulator NC_009782.5559369.p0 Protein 9e-58 57
yycF YP_002775394.1 two-component response regulator NC_002951.3237708.p0 Protein 9e-58 57
yycF YP_002775394.1 two-component response regulator NC_003923.1003749.p0 Protein 8e-58 57
yycF YP_002775394.1 two-component response regulator NC_002758.1121668.p0 Protein 9e-58 57
yycF YP_002775394.1 two-component response regulator NC_007622.3794472.p0 Protein 6e-58 57
yycF YP_002775394.1 two-component response regulator NC_009641.5332272.p0 Protein 9e-58 57
yycF YP_002775394.1 two-component response regulator HE999704.1.gene2815. Protein 3e-54 52
yycF YP_002775394.1 two-component response regulator NC_012469.1.7686381. Protein 2e-46 48
yycF YP_002775394.1 two-component response regulator AE016830.1.gene1681. Protein 3e-49 46
yycF YP_002775394.1 two-component response regulator FJ349556.1.orf0.gene Protein 4e-42 46
yycF YP_002775394.1 two-component response regulator AE000516.2.gene3505. Protein 5e-46 46
yycF YP_002775394.1 two-component response regulator CP001138.1.gene4273. Protein 3e-34 45
yycF YP_002775394.1 two-component response regulator NC_002695.1.915041.p Protein 3e-34 45
yycF YP_002775394.1 two-component response regulator CP000034.1.gene3834. Protein 3e-34 45
yycF YP_002775394.1 two-component response regulator CP001918.1.gene5135. Protein 2e-29 45
yycF YP_002775394.1 two-component response regulator CP004022.1.gene3215. Protein 1e-38 44
yycF YP_002775394.1 two-component response regulator BAC0533 Protein 7e-34 44
yycF YP_002775394.1 two-component response regulator CP000647.1.gene4257. Protein 7e-34 44
yycF YP_002775394.1 two-component response regulator AF162694.1.orf4.gene Protein 3e-36 44
yycF YP_002775394.1 two-component response regulator AF155139.2.orf0.gene Protein 4e-39 44
yycF YP_002775394.1 two-component response regulator BAC0125 Protein 8e-36 43
yycF YP_002775394.1 two-component response regulator NC_005054.2598277.p0 Protein 6e-41 43
yycF YP_002775394.1 two-component response regulator DQ212986.1.gene4.p01 Protein 5e-41 43
yycF YP_002775394.1 two-component response regulator NC_014475.1.orf0.gen Protein 6e-41 43
yycF YP_002775394.1 two-component response regulator BAC0197 Protein 2e-35 43
yycF YP_002775394.1 two-component response regulator HE999704.1.gene1528. Protein 2e-35 42
yycF YP_002775394.1 two-component response regulator AM180355.1.gene1830. Protein 6e-41 42
yycF YP_002775394.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-37 41
yycF YP_002775394.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-37 41
yycF YP_002775394.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-37 41
yycF YP_002775394.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-37 41
yycF YP_002775394.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-37 41
yycF YP_002775394.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-37 41
yycF YP_002775394.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-37 41
yycF YP_002775394.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-37 41
yycF YP_002775394.1 two-component response regulator BAC0083 Protein 4e-33 41
yycF YP_002775394.1 two-component response regulator BAC0638 Protein 4e-28 41
yycF YP_002775394.1 two-component response regulator BAC0111 Protein 2e-34 41
yycF YP_002775394.1 two-component response regulator BAC0308 Protein 1e-31 41
yycF YP_002775394.1 two-component response regulator EU250284.1.orf4.gene Protein 2e-39 41
yycF YP_002775394.1 two-component response regulator CP004022.1.gene1676. Protein 5e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yycF YP_002775394.1 two-component response regulator VFG1389 Protein 4e-33 45
yycF YP_002775394.1 two-component response regulator VFG1390 Protein 2e-37 42
yycF YP_002775394.1 two-component response regulator VFG1563 Protein 6e-39 42
yycF YP_002775394.1 two-component response regulator VFG1702 Protein 8e-39 42
yycF YP_002775394.1 two-component response regulator VFG1386 Protein 2e-36 42
yycF YP_002775394.1 two-component response regulator VFG0596 Protein 5e-35 41