Gene Information

Name : BBR47_58680 (BBR47_58680)
Accession : YP_002775349.1
Strain : Brevibacillus brevis NBRC 100599
Genome accession: NC_012491
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 6219970 - 6220554 bp
Length : 585 bp
Strand : +
Note : -

DNA sequence :
ATGTCAGTAATCAGCTTATCCAAAGGTCAAAAAATTGATCTGACGAAAGGCAATCCGAATCTGACCAAACTGATCGTTGG
ACTCGGTTGGGATACGAACAAATATAACGGTGGATTTGATTTTGACCTCGACGCAGCGGCGTTTTTGCTCCATGCAGACG
GCAAAGCAACTAACATTCAGCACTTTGTTTTCTACAACAACCTACAAGGCGGCAACGGTTCCGTTATTCATACTGGTGAC
AATCTGACGGGTGAAGGCGATGGCGATGATGAACAGATCAAGATCGACCTGACCAAAGTACCGTCCGAGATTGAAAAAAT
CGCCATTACGATTACGATTCACGATGCAGAAAATAGACGCCAAAATTTTGGACAAGTCTCCAACGCATTCGTTCGTGTCG
TTGATGAAAATACGAACCAAGAAGTTCTTCGTTACGACTTGGGCGAGGATTTCTCCGTTGAAACCGCTATTGTCGTATGC
GAATTGTATCGCTACCAGGGCGAGTGGAAGTTTGCTGCGGTGGGCAGTGGTTTTTCCGGCGGCCTCCAAGCGCTTTGCAA
TAACTTCGGATTACAAGCAGGTTAA

Protein sequence :
MSVISLSKGQKIDLTKGNPNLTKLIVGLGWDTNKYNGGFDFDLDAAAFLLHADGKATNIQHFVFYNNLQGGNGSVIHTGD
NLTGEGDGDDEQIKIDLTKVPSEIEKIAITITIHDAENRRQNFGQVSNAFVRVVDENTNQEVLRYDLGEDFSVETAIVVC
ELYRYQGEWKFAAVGSGFSGGLQALCNNFGLQAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-47 59
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-46 57
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-46 57
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-45 56
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-39 53
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-39 53
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-39 53
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-38 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BBR47_58680 YP_002775349.1 tellurium resistance protein BAC0389 Protein 2e-45 55
BBR47_58680 YP_002775349.1 tellurium resistance protein BAC0390 Protein 1e-42 54