Gene Information

Name : BBR47_58670 (BBR47_58670)
Accession : YP_002775348.1
Strain : Brevibacillus brevis NBRC 100599
Genome accession: NC_012491
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 6219352 - 6219933 bp
Length : 582 bp
Strand : +
Note : -

DNA sequence :
ATGGCAGTATCTTTGCAAAAAGGACAAAAGGTTGATTTGACAAAAACGAACCCTGGCTTGACCCAAATCAAGGTAGGTCT
TGGCTGGGATACCAACAAGTATGATGGCGGCGGCGAATTCGACCTGGATGTGTCCGTATTCCTGCTGAACGACCAAGGCA
AAGTGGAAGACGACAAACATTTCGTATTTTTCAACAATCCATCCAGCCCTGACGGCTCCGTTGTTCACTCCGGTGACAAC
CGCACTGGTGATGGCGACGGTGATGACGAAGTGATCGAAATCGACTTGTCCAAAGTTTCCGCGAATATCCAAAAGGTTGC
TTTCACCATCACGATCTACGATGCGGCTACCCGCAACCAAAACTTTGGTCAGGTTTCCAATGCGTATGCGCGTGTACTGA
GCGCAGGCACTGGCGAAGAACTCATTCGCTACGACCTTGGAGAAGATTTCTCCGTTGAAACCGCTGTTGTAGTTGGCGAA
CTGTATCGTCACGGCAGTGAGTGGAAATTCAGCGCAATCGGATCAGGCTACAAAGACGGTCTTGCTGGTCTGGCGCGTGA
TTTTGGTGTTAACATCGGCTAA

Protein sequence :
MAVSLQKGQKVDLTKTNPGLTQIKVGLGWDTNKYDGGGEFDLDVSVFLLNDQGKVEDDKHFVFFNNPSSPDGSVVHSGDN
RTGDGDGDDEVIEIDLSKVSANIQKVAFTITIYDAATRNQNFGQVSNAYARVLSAGTGEELIRYDLGEDFSVETAVVVGE
LYRHGSEWKFSAIGSGYKDGLAGLARDFGVNIG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-48 60
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-48 60
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-48 60
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-49 57
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-45 55
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-45 52
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-44 52
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-45 52
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 6e-27 43
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-23 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BBR47_58670 YP_002775348.1 tellurium resistance protein BAC0390 Protein 7e-49 58
BBR47_58670 YP_002775348.1 tellurium resistance protein BAC0389 Protein 1e-44 52
BBR47_58670 YP_002775348.1 tellurium resistance protein BAC0392 Protein 1e-23 41