Gene Information

Name : BBR47_03530 (BBR47_03530)
Accession : YP_002769834.1
Strain : Brevibacillus brevis NBRC 100599
Genome accession: NC_012491
Putative virulence/resistance : Resistance
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 358262 - 358936 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence : 
ATGCTTATTCTTGCAGTGGAGGATGAAAAAGCGCTGCTTCAGACAATTGCAGGAGTCCTGGCCGACGAAGGATATCAGGT
GGATATGGCAGACCGCGGAGATGACGGCTTGTTATTGGCGGAACGCGGCATCTACGATTTGCTAGTCCTAGACATTATGA
TGCCAGGAATGGATGGTCTTTCACTGGTGAGAACGTTGCGTACAAAAGGGATAATGACGCCGGTTTTATTTTTAACGGCA
AAAGATAGCGTAGAGTCGAGAGTCGAGGGATTGGATGCCGGAGCAGACGATTATTTGGTCAAGCCGTTTGCGGCCGAAGA
ACTGACGGCGAGAGTGAGAGCCCTTTTGCGTCGACAAGGGAAACAGAACACAGAAGGCGAGCTGGCATACGGTCCTCTAT
CGCTGAAGATAAATGAATATGACGGGTTTGTTGATGATGAGCCGATGAAGTTAACCACGAAGGAGTACGAGCTACTCAAG
TACTTCCTGCAAAATCGGGAGCAAATATTGACGCGCCAACAAATTTTTGACCGCGTATGGGGAATTGATTCAGAAGCGAA
TTACGGAGTGGTCGATTTGTATGTCCACTACCTGCGTAAAAAGCTGGGTGCTTACGAAGGCTTCATCCGAACGATCCGCA
ATGTGGGCTACATTTTGAAAAAGGAAAACAAATGA

Protein sequence : 
MLILAVEDEKALLQTIAGVLADEGYQVDMADRGDDGLLLAERGIYDLLVLDIMMPGMDGLSLVRTLRTKGIMTPVLFLTA
KDSVESRVEGLDAGADDYLVKPFAAEELTARVRALLRRQGKQNTEGELAYGPLSLKINEYDGFVDDEPMKLTTKEYELLK
YFLQNREQILTRQQIFDRVWGIDSEANYGVVDLYVHYLRKKLGAYEGFIRTIRNVGYILKKENK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-31 42
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-31 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BBR47_03530 YP_002769834.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-37 42
BBR47_03530 YP_002769834.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-37 42
BBR47_03530 YP_002769834.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-37 42
BBR47_03530 YP_002769834.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-37 42
BBR47_03530 YP_002769834.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-37 42
BBR47_03530 YP_002769834.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-37 42
BBR47_03530 YP_002769834.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-37 42
BBR47_03530 YP_002769834.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-37 42
BBR47_03530 YP_002769834.1 two-component response regulator BAC0347 Protein 8e-32 42
BBR47_03530 YP_002769834.1 two-component response regulator HE999704.1.gene1528. Protein 5e-31 41
BBR47_03530 YP_002769834.1 two-component response regulator AF310956.2.orf0.gene Protein 1e-31 41
BBR47_03530 YP_002769834.1 two-component response regulator BAC0111 Protein 7e-36 41
BBR47_03530 YP_002769834.1 two-component response regulator BAC0308 Protein 1e-34 41
BBR47_03530 YP_002769834.1 two-component response regulator BAC0197 Protein 3e-32 41
BBR47_03530 YP_002769834.1 two-component response regulator BAC0638 Protein 1e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BBR47_03530 YP_002769834.1 two-component response regulator VFG0473 Protein 3e-34 42
BBR47_03530 YP_002769834.1 two-component response regulator VFG0596 Protein 4e-32 42
BBR47_03530 YP_002769834.1 two-component response regulator VFG1390 Protein 2e-37 42
BBR47_03530 YP_002769834.1 two-component response regulator VFG1389 Protein 2e-36 42