Gene Information

Name : BBR47_28750 (BBR47_28750)
Accession : YP_002772356.1
Strain : Brevibacillus brevis NBRC 100599
Genome accession: NC_012491
Putative virulence/resistance : Resistance
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3002029 - 3002682 bp
Length : 654 bp
Strand : +
Note : -

DNA sequence :
ATGATAAAAATTTTAGTGGTTGAAGATGATATCGCAGTAGCAAATTTAATTAAATTGAATTTAAATACAGCAAATTATGA
GAGTACAGTCGTTTTTGATGGAGAGGAAGCCCTAAATGTGATTGAAAGAGATCGTTTTGATCTCATACTTTTGGATGTGA
TGCTTCCGAAAGTTGATGGATTTACTTTATTCGAAAAAATTAAACCTTTAGGGATACCTGTCATTTTTTTAACTGCGAAA
AGTTCGGTCACAGATAAGGTGTATGGATTAAAAGCGGGAGTAGATGACTATATGACGAAACCGTTTGAAGGAATTGAATT
GCTGGCCAGGATTGAAAATGTATTACGGCATTACAATAAAAAAAGCAACATCATAAATTTTAAAGACACAGAAGTATACT
TGGAAGAAATGAAGGTGAAAAAGAACGGTGAAATGATTGAGCTTACCTTGAAGGAGTTCGAATTATTGGTGTTTTTAGTG
CAAAATAAAAACATCGTATTAACGAGGGAAAAAATCATAGAAAAAATTTGGGGATATGACTACGTTGGTGAGACTCGGAC
GATTGACAACCATATACAAAAGCTAAGAAAAAAGCTGGGATGGAAAGATGAAATTAAAACAGTATTTAAATTGGGATATA
GGCTGGAGGAATAA

Protein sequence :
MIKILVVEDDIAVANLIKLNLNTANYESTVVFDGEEALNVIERDRFDLILLDVMLPKVDGFTLFEKIKPLGIPVIFLTAK
SSVTDKVYGLKAGVDDYMTKPFEGIELLARIENVLRHYNKKSNIINFKDTEVYLEEMKVKKNGEMIELTLKEFELLVFLV
QNKNIVLTREKIIEKIWGYDYVGETRTIDNHIQKLRKKLGWKDEIKTVFKLGYRLEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 1e-30 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BBR47_28750 YP_002772356.1 two-component response regulator NC_002952.2859905.p0 Protein 2e-39 42
BBR47_28750 YP_002772356.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-39 42
BBR47_28750 YP_002772356.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-39 42
BBR47_28750 YP_002772356.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-39 42
BBR47_28750 YP_002772356.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-39 42
BBR47_28750 YP_002772356.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-39 42
BBR47_28750 YP_002772356.1 two-component response regulator NC_007622.3794472.p0 Protein 2e-39 42
BBR47_28750 YP_002772356.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-39 42
BBR47_28750 YP_002772356.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-39 42
BBR47_28750 YP_002772356.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-39 42
BBR47_28750 YP_002772356.1 two-component response regulator NC_010079.5776364.p0 Protein 3e-32 41
BBR47_28750 YP_002772356.1 two-component response regulator NC_002952.2859858.p0 Protein 3e-32 41
BBR47_28750 YP_002772356.1 two-component response regulator NC_007622.3794948.p0 Protein 3e-32 41
BBR47_28750 YP_002772356.1 two-component response regulator NC_003923.1003417.p0 Protein 3e-32 41
BBR47_28750 YP_002772356.1 two-component response regulator NC_013450.8614146.p0 Protein 3e-32 41
BBR47_28750 YP_002772356.1 two-component response regulator NC_002951.3238224.p0 Protein 3e-32 41
BBR47_28750 YP_002772356.1 two-component response regulator NC_007793.3914065.p0 Protein 3e-32 41
BBR47_28750 YP_002772356.1 two-component response regulator NC_002758.1121390.p0 Protein 3e-32 41
BBR47_28750 YP_002772356.1 two-component response regulator AF155139.2.orf0.gene Protein 3e-34 41
BBR47_28750 YP_002772356.1 two-component response regulator HE999704.1.gene1528. Protein 4e-28 41
BBR47_28750 YP_002772356.1 two-component response regulator NC_012469.1.7685629. Protein 3e-34 41