Gene Information

Name : mprA (RER_43980)
Accession : YP_002767845.1
Strain : Rhodococcus erythropolis PR4
Genome accession: NC_012490
Putative virulence/resistance : Virulence
Product : two-component response regulator MprA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4829992 - 4830678 bp
Length : 687 bp
Strand : -
Note : -

DNA sequence :
ATGCGTATTTTGGTGGTCGACGACGACCGGGCGGTTCGCGAGTCGCTTCGGCGGTCGCTCAGCTTCAACGGCTACACGGT
CGAGCTCGCGGTCGACGGGCTCGACGCACTCGAGAAGATCCTCGCCAACCGGCCAGACGCCGTCGTGCTCGACGTCATGA
TGCCGCGACTCGACGGACTCGAAGTGTGCCGTCGTCTTCGCAGTGCCGGCGACGACCTGCCCATCCTCGTGCTCACCGCC
CGCGATTCGGTCAGCGAGCGAGTCGCCGGCCTCGATGCCGGAGCGGACGACTACCTGCCCAAGCCCTTCGCTTTGGAAGA
GTTGCTTGCCAGGTTGCGTGCACTTCTGCGTCGCACCGCGCCCGATCTGGACGCCGATTCCGAAATGATGGCGTTCGAGG
ACCTCACCCTCGACCCGGTCACCCGTGAGGTCAAGCGCGGTGAACGATCGATCAGCCTGACTCGTACCGAGTTTTCCCTT
CTCGAAATGCTCATGGCCAACCCGCGTCGCGTGCTCACCCGTGGACGCATTCTCGAAGAGGTGTGGGGGTACGACTTCCC
GACGTCCGGCAATGCGCTCGAGGTGTACGTCGGCTACCTGCGTCGCAAGACGGAAGCCGACGGCGAACCGAGGTTGATCC
ACACCGTCCGCGGAGTCGGCTACGTCCTGCGGGAGACGCCTCCGTGA

Protein sequence :
MRILVVDDDRAVRESLRRSLSFNGYTVELAVDGLDALEKILANRPDAVVLDVMMPRLDGLEVCRRLRSAGDDLPILVLTA
RDSVSERVAGLDAGADDYLPKPFALEELLARLRALLRRTAPDLDADSEMMAFEDLTLDPVTREVKRGERSISLTRTEFSL
LEMLMANPRRVLTRGRILEEVWGYDFPTSGNALEVYVGYLRRKTEADGEPRLIHTVRGVGYVLRETPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-32 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-31 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_002767845.1 two-component response regulator MprA HE999704.1.gene1528. Protein 1e-38 47
mprA YP_002767845.1 two-component response regulator MprA BAC0125 Protein 1e-32 45
mprA YP_002767845.1 two-component response regulator MprA AE000516.2.gene3505. Protein 2e-33 45
mprA YP_002767845.1 two-component response regulator MprA BAC0111 Protein 8e-35 44
mprA YP_002767845.1 two-component response regulator MprA BAC0638 Protein 5e-28 44
mprA YP_002767845.1 two-component response regulator MprA BAC0308 Protein 2e-31 43
mprA YP_002767845.1 two-component response regulator MprA BAC0083 Protein 6e-35 43
mprA YP_002767845.1 two-component response regulator MprA BAC0197 Protein 4e-29 42
mprA YP_002767845.1 two-component response regulator MprA NC_013450.8614146.p0 Protein 9e-35 41
mprA YP_002767845.1 two-component response regulator MprA NC_002951.3238224.p0 Protein 9e-35 41
mprA YP_002767845.1 two-component response regulator MprA NC_007793.3914065.p0 Protein 9e-35 41
mprA YP_002767845.1 two-component response regulator MprA NC_002758.1121390.p0 Protein 9e-35 41
mprA YP_002767845.1 two-component response regulator MprA NC_010079.5776364.p0 Protein 9e-35 41
mprA YP_002767845.1 two-component response regulator MprA NC_002952.2859858.p0 Protein 9e-35 41
mprA YP_002767845.1 two-component response regulator MprA NC_007622.3794948.p0 Protein 9e-35 41
mprA YP_002767845.1 two-component response regulator MprA NC_003923.1003417.p0 Protein 9e-35 41
mprA YP_002767845.1 two-component response regulator MprA NC_012469.1.7686381. Protein 2e-32 41
mprA YP_002767845.1 two-component response regulator MprA U82965.2.orf14.gene. Protein 6e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_002767845.1 two-component response regulator MprA VFG1390 Protein 2e-83 87
mprA YP_002767845.1 two-component response regulator MprA VFG1389 Protein 2e-43 52
mprA YP_002767845.1 two-component response regulator MprA VFG1386 Protein 2e-44 50
mprA YP_002767845.1 two-component response regulator MprA VFG0596 Protein 1e-32 42