Gene Information

Name : RER_40710 (RER_40710)
Accession : YP_002767518.1
Strain : Rhodococcus erythropolis PR4
Genome accession: NC_012490
Putative virulence/resistance : Resistance
Product : putative tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 4464053 - 4464628 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
ATGGGCGTCACACTTGCCAAGGGCGGCAACGTATCTCTGTCGAAGGCCGCACCCAATCTGACCAAGGTCGCAGTCGGTCT
CGGCTGGGATGCACGCAGCACCAGTGGTGCCGACTTCGACCTCGACGCCAGCGCGTTGGTCACCGGCCCGGAACGCAAGG
TTCTTTCCGACCTGCACTTCGTCTTCTACAACAACCTTCGCTCGCCCGACGGATCCATCGAGCACACCGGCGACAACCTC
ACCGGTGAAGGTGACGGCGACGACGAAGTCATCAACGTCGACCTCCCGGCTGTACCGCCCAACGTCACCAACATCTTCTT
CCCCGTATCGATTCACGACGCCGATGCCCGACTCCAGTCCTTCGGGCAGGTCACCAACGCCTACATCCGCGTCGTAGATC
TGTCGAATGGATCCGAGCTGGCACGATACGACCTCTCGGAAGACGCTTCCACCGAGACCGCCATGCTTTTCGGTGAGCTC
TACCGCCACAACGGCGAATGGAAGTTCCGCGCAGTCGGACAGGGCTACGCATCCGGACTCGCCGGCATCGCCCGCGACTA
CGGCGTCAACATCTGA

Protein sequence :
MGVTLAKGGNVSLSKAAPNLTKVAVGLGWDARSTSGADFDLDASALVTGPERKVLSDLHFVFYNNLRSPDGSIEHTGDNL
TGEGDGDDEVINVDLPAVPPNVTNIFFPVSIHDADARLQSFGQVTNAYIRVVDLSNGSELARYDLSEDASTETAMLFGEL
YRHNGEWKFRAVGQGYASGLAGIARDYGVNI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 69
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 69
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-59 68
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-56 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-59 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 4e-55 61
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-55 61
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-55 61
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-29 42
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-25 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RER_40710 YP_002767518.1 putative tellurium resistance protein BAC0389 Protein 5e-59 67
RER_40710 YP_002767518.1 putative tellurium resistance protein BAC0390 Protein 4e-58 63
RER_40710 YP_002767518.1 putative tellurium resistance protein BAC0392 Protein 2e-25 41