Gene Information

Name : GAU_3842 (GAU_3842)
Accession : YP_002763354.1
Strain : Gemmatimonas aurantiaca T-27
Genome accession: NC_012489
Putative virulence/resistance : Virulence
Product : OmpR family two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4522543 - 4523223 bp
Length : 681 bp
Strand : +
Note : -

DNA sequence :
ATGCGCCTGCTCGTCGTTGAAGATGACCCGAAACTGGCCCGTCTCATTGCGCGCGGGCTGCGCGAAGAGTCGTACGCCGT
AGACACCTGCGAGCTGGGCAAGGACGCCATCGCGCAGGCGGCGGTGAACAGCTACGATGCGATCGTGCTCGACGTGATGT
TGCCCGATATCAATGGCTTCACCGTCGTGCAGACGCTGCGCACGCGCGATATCCGTACACCGGTGCTGATGCTCACCTCG
CGCGACGCGGTGGCGGATCGCATCGTCGGGCTCGACAGCGGCGCCGACGACTATCTCGTCAAGCCGTTCGACTTCGGTGA
GCTGCTCGCGCGCTTGCGGGCCCTGTTGCGTCGACCGGAATCCTTGCAGGCCATGCAGGTGCGCGTTGCCGATCTGGAAA
TCGACCTGCAGTCGCACGCGGTATCCCGTGGTGGCACCCCCATCTCGCTCACGGCCAAGGAGTACGCGCTGCTGGAGTTG
CTCGCACGCAACGTGGGCCGTGTGCTTTCGCGCAGTGACATCGTGTCGCACGTATGGGATGACAATCACGATCCGTTCAC
CAATGCGGTGGAGGTGTACGTCAATCGCCTGCGCGGCAAGATCGATCGGGATGGTCATGCACCGCTCATCCACACACGGC
GCGGCGCGGGGTACATCCTCACCGACATTCCGCCGGCCTGA

Protein sequence :
MRLLVVEDDPKLARLIARGLREESYAVDTCELGKDAIAQAAVNSYDAIVLDVMLPDINGFTVVQTLRTRDIRTPVLMLTS
RDAVADRIVGLDSGADDYLVKPFDFGELLARLRALLRRPESLQAMQVRVADLEIDLQSHAVSRGGTPISLTAKEYALLEL
LARNVGRVLSRSDIVSHVWDDNHDPFTNAVEVYVNRLRGKIDRDGHAPLIHTRRGAGYILTDIPPA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-36 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-36 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GAU_3842 YP_002763354.1 OmpR family two-component response regulator BAC0083 Protein 2e-44 53
GAU_3842 YP_002763354.1 OmpR family two-component response regulator BAC0638 Protein 7e-38 53
GAU_3842 YP_002763354.1 OmpR family two-component response regulator BAC0125 Protein 1e-42 50
GAU_3842 YP_002763354.1 OmpR family two-component response regulator BAC0308 Protein 4e-41 50
GAU_3842 YP_002763354.1 OmpR family two-component response regulator BAC0197 Protein 3e-42 50
GAU_3842 YP_002763354.1 OmpR family two-component response regulator BAC0111 Protein 8e-43 49
GAU_3842 YP_002763354.1 OmpR family two-component response regulator BAC0347 Protein 4e-37 47
GAU_3842 YP_002763354.1 OmpR family two-component response regulator NC_013450.8614146.p0 Protein 1e-31 43
GAU_3842 YP_002763354.1 OmpR family two-component response regulator NC_002951.3238224.p0 Protein 1e-31 43
GAU_3842 YP_002763354.1 OmpR family two-component response regulator NC_007793.3914065.p0 Protein 1e-31 43
GAU_3842 YP_002763354.1 OmpR family two-component response regulator NC_002758.1121390.p0 Protein 1e-31 43
GAU_3842 YP_002763354.1 OmpR family two-component response regulator NC_010079.5776364.p0 Protein 1e-31 43
GAU_3842 YP_002763354.1 OmpR family two-component response regulator NC_002952.2859858.p0 Protein 1e-31 43
GAU_3842 YP_002763354.1 OmpR family two-component response regulator NC_007622.3794948.p0 Protein 1e-31 43
GAU_3842 YP_002763354.1 OmpR family two-component response regulator NC_003923.1003417.p0 Protein 1e-31 43
GAU_3842 YP_002763354.1 OmpR family two-component response regulator HE999704.1.gene1528. Protein 6e-32 43
GAU_3842 YP_002763354.1 OmpR family two-component response regulator AE000516.2.gene3505. Protein 1e-30 42
GAU_3842 YP_002763354.1 OmpR family two-component response regulator BAC0487 Protein 2e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GAU_3842 YP_002763354.1 OmpR family two-component response regulator VFG0596 Protein 1e-36 46
GAU_3842 YP_002763354.1 OmpR family two-component response regulator VFG1390 Protein 2e-37 45
GAU_3842 YP_002763354.1 OmpR family two-component response regulator VFG1386 Protein 2e-33 42