Gene Information

Name : merR (GAU_3513)
Accession : YP_002763025.1
Strain : Gemmatimonas aurantiaca T-27
Genome accession: NC_012489
Putative virulence/resistance : Resistance
Product : putative mercuric resistance operon regulatory protein
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 4133829 - 4134242 bp
Length : 414 bp
Strand : +
Note : -

DNA sequence : 
ATGAAAGTCCCTTTGCGCATCGGGGCCGTCGCTGAGGCGGCGGGCGTGGGCGTGCAGACGCTCCGGTACTACGAGCGGCG
CGGCCTGTTGAGCGCTCGCCACCGCACGGCAGGCGGCTACCGTGAATACGCTCCGGACACGGTCCGTCGCGTCGTGTTCA
TTCGCCGCGCGCAGGCGATGGGATTCACGCTCGATGAGATTCGCGCGCTCCTCGCGCTTCGTGTGCGGGAGCCGCGACGT
TGCGAGCCGGTGAAGGAGTCCGCCGAGATCGCGCGCGCGCGCGTCCGCGAGCAGCTCGTCGCGCTGCGACGGATGGACAA
GGTGCTCGCACGGCTCATTCGTGCGTGCGACGCGCGAGCGGTCACGGAGGAGTGCCCCATCCTGGCGGCGCTCGAACCTG
AGGAGAGGAGTTAG

Protein sequence : 
MKVPLRIGAVAEAAGVGVQTLRYYERRGLLSARHRTAGGYREYAPDTVRRVVFIRRAQAMGFTLDEIRALLALRVREPRR
CEPVKESAEIARARVREQLVALRRMDKVLARLIRACDARAVTEECPILAALEPEERS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AGK07025.1 MerR Not tested SGI1 Protein 3e-19 42
merR AGK07083.1 MerR Not tested SGI1 Protein 3e-19 42
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 6e-18 41
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 7e-19 41
merR ACK44535.1 MerR Not tested SGI1 Protein 5e-19 41
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 5e-19 41
merR AFG30124.1 MerR Not tested PAGI-2 Protein 5e-19 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merR YP_002763025.1 putative mercuric resistance operon regulatory protein BAC0689 Protein 2e-18 42
merR YP_002763025.1 putative mercuric resistance operon regulatory protein BAC0686 Protein 5e-20 41
merR YP_002763025.1 putative mercuric resistance operon regulatory protein BAC0688 Protein 1e-19 41