Gene Information

Name : GAU_2904 (GAU_2904)
Accession : YP_002762416.1
Strain : Gemmatimonas aurantiaca T-27
Genome accession: NC_012489
Putative virulence/resistance : Resistance
Product : heavy metal-binding protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 3413879 - 3414088 bp
Length : 210 bp
Strand : -
Note : -

DNA sequence : 
ATGCAGTCCCTCAAGCTCGAAATCAGCGGCATGTCCTGCGGCCACTGTGTGAAGGCCGTCGACAAGGCCCTCTCGAAGGT
CGATGGCGTCACCGTGCAGTCCGTCGGTGTCGGTGAGGCCACGGTGTCCTTCGACCCTTCCCGTGCCACCTCGCAGCAAC
TCGCCGAAGCCGTGGCCGACGCCGGCTTTCAGCTCACCGGTTCGCACTAG

Protein sequence : 
MQSLKLEISGMSCGHCVKAVDKALSKVDGVTVQSVGVGEATVSFDPSRATSQQLAEAVADAGFQLTGSH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 4e-09 47
merP ABQ57373.1 MerP Not tested SGI1 Protein 3e-09 47
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 3e-09 47
merP AFG30122.1 MerP Not tested PAGI-2 Protein 3e-09 47
merP AGK07023.1 MerP Not tested SGI1 Protein 3e-09 47
merP AGK07081.1 MerP Not tested SGI1 Protein 3e-09 47
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 7e-09 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GAU_2904 YP_002762416.1 heavy metal-binding protein BAC0674 Protein 3e-08 42