
| Name : rpmE2 (SZO_12080) Accession : YP_002744734.1 Strain : Streptococcus equi H70 Genome accession: NC_012470 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L31 type B Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0254 EC number : - Position : 1346370 - 1346630 bp Length : 261 bp Strand : + Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g DNA sequence : ATGAGAAAAGACATTCATCCAGATTATCGTCCAGTTGTTTTCCTTGATACAACTACAGGCTACAAATTCCTTAGCGGTTC AACTAAGGCCTCTAAAGAAACCATTGAGTTTGAAGGGGAAACTTACCCTCTTGTTCGTGTAGAAATTTCATCAGACTCAC ACCCATTCTACACAGGTCGTCAAAAGTTTACACAAGCCGATGGACGTGTGGATCGTTTCAACAAGAAATACGGTCTCAAA GACGCAAACGCAGCAAAATAA Protein sequence : MRKDIHPDYRPVVFLDTTTGYKFLSGSTKASKETIEFEGETYPLVRVEISSDSHPFYTGRQKFTQADGRVDRFNKKYGLK DANAAK | 
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity | 
| rpmE2 | NP_286687.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 2e-13 | 47 | 
| rpmE2 | NP_287095.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 2e-13 | 47 | 
 
 
  