|
Name : SP70585_2133 (SP70585_2133) Accession : YP_002741313.1 Strain : Streptococcus pneumoniae 70585 Genome accession: NC_012468 Putative virulence/resistance : Unknown Product : mobile genetic element Function : - COG functional category : L : Replication, recombination and repair COG ID : COG3293 EC number : - Position : 1955630 - 1955914 bp Length : 285 bp Strand : + Note : an automated process has identified a potential problem with this gene model; the current end5 and/or the end3 may need to extended or the current gene model may need to be merged with a neighboring gene model; the current gene model (or a revised gene mo DNA sequence : ATGGAACCTCAAGCGATTGTCACAAGTCAAGGGAGAATTGTTTCTTTGGATATCGCTGTGAACTATTGTCATGATATGAA GTTGTTCAAAATGAGTCGCAGAAATATCGGACAAGCTGGTAAAATCTTGGCCGACAGTGGTTATCAAGGGCTCATGAAGA TATATCCTCAAGCACAAACTCCACGTAAATCCAGCAAACTCAAGCCGCTAACAGCTGAAGATAAAGCCTGTAACCATGCG CTATCTAAGGGAGAAGCAAGGTTGAGAACATCTTTGCCAAAGTAA Protein sequence : MEPQAIVTSQGRIVSLDIAVNYCHDMKLFKMSRRNIGQAGKILADSGYQGLMKIYPQAQTPRKSSKLKPLTAEDKACNHA LSKGEARLRTSLPK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| smi_1693 | YP_003446795.1 | transposase orfB, IS1381 | Not tested | The aminoglycoside resistance gene cluster | Protein | 3e-32 | 80 |
