
|
Name : SPP_2265 (SPP_2265) Accession : YP_002739292.1 Strain : Streptococcus pneumoniae P1031 Genome accession: NC_012467 Putative virulence/resistance : Unknown Product : transposase Function : - COG functional category : L : Replication, recombination and repair COG ID : COG3436 EC number : - Position : 2083651 - 2083938 bp Length : 288 bp Strand : - Note : an automated process has identified a potential problem with this gene model; the current end5 and/or the end3 may need to extended or the current gene model may need to be merged with a neighboring gene model; the current gene model (or a revised gene mo DNA sequence : ATGATGATTCAACTAAGTGATTTAGGTCAAGTTCACATTGTTTGTGGCAAGACAGATATGAGGCAGGGAATAGACTCATT AGCCTATGTAGTTAAAACCCACTTTGAATTGGATTCTTTCTCCGGTCAAGTCTTTCTCTTTTGTGGTGGACGTAAAGACC GCTTTAAAGTCCTTTACTGGGATGGTCAAGGATTTTGGCTACTATATAAACGCTTTGAGAACGGAAAACTGACTTGGCTA AGTACAGAAAAGGATGTCAAAGCTCTCGCACCTGAACAAGTAGACTAG Protein sequence : MMIQLSDLGQVHIVCGKTDMRQGIDSLAYVVKTHFELDSFSGQVFLFCGGRKDRFKVLYWDGQGFWLLYKRFENGKLTWL STEKDVKALAPEQVD |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| BCAM0247 | YP_002232879.1 | putative transposase | Not tested | BcenGI11 | Protein | 2e-12 | 45 |
| l0014 | CAD33776.1 | L0014 protein | Not tested | PAI I 536 | Protein | 9e-08 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| SPP_2265 | YP_002739292.1 | transposase | VFG1517 | Protein | 4e-08 | 41 |