Gene Information

Name : SPP_1464 (SPP_1464)
Accession : YP_002738584.1
Strain : Streptococcus pneumoniae P1031
Genome accession: NC_012467
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 1363722 - 1363958 bp
Length : 237 bp
Strand : -
Note : an automated process has identified a potential problem with this gene model; the current end5 and/or the end3 may need to extended or the current gene model may need to be merged with a neighboring gene model; the current gene model (or a revised gene mo

DNA sequence :

ATGACAATTCATCTATCTAGCCTAGGGCAGGTCTATCTCGTATGTGGGAAAACGGATATGAGGCAAGGCATTGATTCACT
GGCTTATCTGGTTAAAACCCACTTTGAATTAGATCCTTTCTCCGGTCAAGTTTTTCTCTTTTGTGGTGGACGTAAAGACC
GCTTTAAAGCCCTTTACTGGGATGGTCAAGGATTTTGGCTACTATATAAACGCTTTGAGAACGGCAGACTGACTTGA

Protein sequence :

MTIHLSSLGQVYLVCGKTDMRQGIDSLAYLVKTHFELDPFSGQVFLFCGGRKDRFKALYWDGQGFWLLYKRFENGRLT

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
l0014	CAD33776.1	L0014 protein	Not tested	PAI I 536	Protein	5e-07	45

• Homologs from VFDB (virulence genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
SPP_1464	YP_002738584.1	transposase	VFG1517	Protein	2e-07	45